• Gene id: 602

Gene Summary

• Gene Symbol: BCL3   Gene   UCSC   Ensembl
• Aliases: BCL4, D19S37
• Gene name: BCL3 transcription coactivator
• Alternate names: B-cell lymphoma 3 protein, B cell CLL/lymphoma 3, B-cell leukemia/lymphoma 3, B-cell lymphoma 3-encoded protein, BCL-3, chronic lymphatic leukemia protein, proto-oncogene BCL3,
• Gene location: 19q13.32 (44742619: 44760043)     Exons: 13     NC_000019.10
• Gene summary(Entrez): This gene is a proto-oncogene candidate. It is identified by its translocation into the immunoglobulin alpha-locus in some cases of B-cell leukemia. The protein encoded by this gene contains seven ankyrin repeats, which are most closely related to those f
• OMIM: 109560

Protein Summary

• Protein general information: P20749  
  • Name: B cell lymphoma 3 protein (BCL 3) (Proto oncogene BCL3)
  • Length: 454  
  • Mass: 47584
• Sequence:

  MPRCPAGAMDEGPVDLRTRPKAAGLPGAALPLRKRPLRAPSPEPAAPRGAAGLVVPLDPLRGGCDLPAVPGPPHG
  LARPEALYYPGALLPLYPTRAMGSPFPLVNLPTPLYPMMCPMEHPLSADIAMATRADEDGDTPLHIAVVQGNLPA
  VHRLVNLFQQGGRELDIYNNLRQTPLHLAVITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALL
  DSAAPGTLDLEARNYDGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGA
  NVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRGKATRPASTSQPDPSP
  DRSANTSPESSSRLSSNGLLSASPSSSPSQSPPRDPPGFPMAPPNFFLPSPSPPAFLPFAGVLRGPGRPVPPSPA
  PGGS

• Structural information:
  • Interpro: IPR002110  IPR020683  IPR036770  
  • Prosite: PS50297 PS50088
  • PDB: 1K1A 1K1B
  • PDBsum: 1K1A 1K1B
  • STRING: ENSP00000164227
• Other Databases: GeneCards:  BCL3  Malacards:  BCL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0002268	follicular dendritic cell differentiation	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0042088	T-helper 1 type immune response	IEA	biological process
GO:0042832	defense response to protozoan	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0002315	marginal zone B cell differentiation	IEA	biological process
GO:0002455	humoral immune response mediated by circulating immunoglobulin	IEA	biological process
GO:0002467	germinal center formation	IEA	biological process
GO:0019730	antimicrobial humoral response	IEA	biological process
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0032729	positive regulation of interferon-gamma production	IEA	biological process
GO:0042536	negative regulation of tumor necrosis factor biosynthetic process	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0045064	T-helper 2 cell differentiation	IEA	biological process
GO:0045082	positive regulation of interleukin-10 biosynthetic process	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0048536	spleen development	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0010225	response to UV-C	IDA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0042981	regulation of apoptotic process	IDA	biological process
GO:0032996	Bcl3-Bcl10 complex	IDA	cellular component
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0006351	transcription, DNA-templated	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0033257	Bcl3/NF-kappaB2 complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0046426	negative regulation of receptor signaling pathway via JAK-STAT	IMP	biological process
GO:0051101	regulation of DNA binding	IEP	biological process
GO:0030674	protein-macromolecule adaptor activity	TAS	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0051457	maintenance of protein location in nucleus	NAS	biological process
GO:0045727	positive regulation of translation	IMP	biological process
GO:0045415	negative regulation of interleukin-8 biosynthetic process	IMP	biological process
GO:1901222	regulation of NIK/NF-kappaB signaling	IEP	biological process
GO:0030330	DNA damage response, signal transduction by p53 class mediator	IMP	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04668	TNF signaling pathway
hsa04625	C-type lectin receptor signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq