• Gene id: 6019

Gene Summary

• Gene Symbol: RLN2   Gene   UCSC   Ensembl
• Aliases: H2, H2-RLX, RLXH2, bA12D24.1.1, bA12D24.1.2
• Gene name: relaxin 2
• Alternate names: prorelaxin H2, H2-preprorelaxin, relaxin H2, relaxin, ovarian, of pregnancy,
• Gene location: 9p24.1 (5339437: 5299863)     Exons: 9     NC_000009.12
• Gene summary(Entrez): This gene encodes a member of the relaxin subfamily and insulin superfamily of peptide hormones. In humans there are three non-allelic relaxin genes. This gene encodes multiple protein isoforms, at least one of which undergoes proteolytic processing. This
• OMIM: 179740

Protein Summary

• Protein general information: P04090  
  • Name: Prorelaxin H2 [Cleaved into: Relaxin B chain; Relaxin A chain]
  • Length: 185  
  • Mass: 21043
  • Tissue specificity: Isoform 1 is expressed in the ovary during pregnancy. Also expressed in placenta, decidua and prostate. Isoform 2 is relatively abundant in placenta. It is in much lower abundance in the prostate gland. Not detected in the ovary. {ECO
• Sequence:

  MPRLFFFHLLGVCLLLNQFSRAVADSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPS
  FINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAADSSPSELKY
  LGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFC

• Structural information:
  • Interpro: IPR016179  IPR036438  IPR022353  IPR022352  IPR022421  
  • Prosite: PS00262
  • PDB: 2MV1 6RLX
  • PDBsum: 2MV1 6RLX
  • STRING: ENSP00000371040
• Other Databases: GeneCards:  RLN2  Malacards:  RLN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0050790	regulation of catalytic activity	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0007565	female pregnancy	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04926	Relaxin signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)