• Gene id: 6014

Gene Summary

• Gene Symbol: RIT2   Gene   UCSC   Ensembl
• Aliases: RIBA, RIN, ROC2
• Gene name: Ras like without CAAX 2
• Alternate names: GTP-binding protein Rit2, GTP-binding protein Roc2, Ric-like, expressed in neurons, ras-like protein expressed in neurons, ras-like without CAAX protein 2,
• Gene location: 18q12.3 (43115691: 42743217)     Exons: 6     NC_000018.10
• Gene summary(Entrez): RIN belongs to the RAS (HRAS; MIM 190020) superfamily of small GTPases (Shao et al., 1999 [PubMed 10545207]).[supplied by OMIM, Mar 2008]
• OMIM: 609592

Protein Summary

• Protein general information: Q99578  
  • Name: GTP binding protein Rit2 (Ras like protein expressed in neurons) (Ras like without CAAX protein 2)
  • Length: 217  
  • Mass: 24668
  • Tissue specificity: Neuron-specific.
• Sequence:

  MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDT
  AGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGLS
  LAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDSLWKKLKGSLKKKRENMT

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  IPR020849  
  • Prosite: PS51421
  • STRING: ENSP00000321805
• Other Databases: GeneCards:  RIT2  Malacards:  RIT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005516	calmodulin binding	IDA	molecular function
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0042802	identical protein binding	IDA	NOT|molecular function
GO:0003924	GTPase activity	ISS	molecular function
GO:0043005	neuron projection	IDA	cellular component
GO:0030215	semaphorin receptor binding	IPI	molecular function
GO:0005516	calmodulin binding	ISS	molecular function
GO:0005525	GTP binding	ISS	molecular function
GO:0045121	membrane raft	IDA	cellular component
GO:0007265	Ras protein signal transduction	ISS	biological process
GO:0097447	dendritic tree	ISS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0044297	cell body	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0032489	regulation of Cdc42 protein signal transduction	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0043410	positive regulation of MAPK cascade	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0010976	positive regulation of neuron projection development	ISS	biological process
GO:0010976	positive regulation of neuron projection development	ISS	biological process
GO:0010976	positive regulation of neuron projection development	IGI	biological process
GO:0050848	regulation of calcium-mediated signaling	ISS	biological process
GO:0000165	MAPK cascade	ISS	NOT|biological process
GO:0030100	regulation of endocytosis	IMP	biological process
GO:0032507	maintenance of protein location in cell	IMP	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0010976	positive regulation of neuron projection development	IBA	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0005516	calmodulin binding	IBA	molecular function
GO:0005525	GTP binding	IBA	molecular function
GO:0007265	Ras protein signal transduction	IBA	biological process
GO:0019003	GDP binding	IBA	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005516	calmodulin binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0097447	dendritic tree	IEA	cellular component
GO:0044297	cell body	IEA	cellular component
GO:0032489	regulation of Cdc42 protein signal transduction	IEA	biological process
GO:0007265	Ras protein signal transduction	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0050848	regulation of calcium-mediated signaling	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0001932	regulation of protein phosphorylation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0007264	small GTPase mediated signal transduction	NAS	biological process
GO:0003924	GTPase activity	NAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)