• Gene id: 6013

Gene Summary

• Gene Symbol: RLN1   Gene   UCSC   Ensembl
• Aliases: H1, H1RLX, RLXH1, bA12D24.3.1, bA12D24.3.2
• Gene name: relaxin 1
• Alternate names: prorelaxin H1, preprorelaxin H1,
• Gene location: 9p24.1 (5340914: 5299863)     Exons: 13     NC_000009.12
• Gene summary(Entrez): Relaxins are known endocrine and autocrine/paracrine hormones, belonging to the insulin gene superfamily. In humans there are three non-allelic relaxin genes, RLN1, RLN2 and RLN3, where RLN1 and RLN2 share high sequence homology. The protein encoded by th
• OMIM: 179530

Protein Summary

• Protein general information: P04808  
  • Name: Prorelaxin H1 [Cleaved into: Relaxin B chain; Relaxin A chain]
  • Length: 185  
  • Mass: 21146
  • Tissue specificity: Prostate. Not expressed in placenta, decidua or ovary. {ECO
• Sequence:

  MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPS
  FINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKY
  LGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC

• Structural information:
  • Interpro: IPR016179  IPR036438  IPR022353  IPR022352  IPR022421  
  • Prosite: PS00262
  • STRING: ENSP00000223862
• Other Databases: GeneCards:  RLN1  Malacards:  RLN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005179	hormone activity	TAS	molecular function
GO:0007165	signal transduction	NAS	biological process
GO:0007565	female pregnancy	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04926	Relaxin signaling pathway

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
3364508	Fertilization capacity and motility of human spermatozoa in oligospermic and asthenospermic subjects			41 (10 oligospermic men (group A), 11 asthenospermic men (group B), 10 normospermic infertile men (group C), 10 men with verified fertility (group D))	Male infertility	Relaxin