About Us

Search Result


Gene id 6011
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol GRK1   Gene   UCSC   Ensembl
Aliases GPRK1, RHOK, RK
Gene name G protein-coupled receptor kinase 1
Alternate names rhodopsin kinase GRK1, rhodopsin kinase,
Gene location 13q34 (113645770: 113737735)     Exons: 8     NC_000013.11
Gene summary(Entrez) This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates rhodopsin and initiates its deactivation. Defects in GRK1 are known to caus
OMIM 608252

Protein Summary

Protein general information Q15835  

Name: Rhodopsin kinase GRK1 (RK) (EC 2.7.11.14) (G protein coupled receptor kinase 1)

Length: 563  Mass: 63526

Tissue specificity: Retinal-specific. Expressed in rods and cones cells. {ECO

Sequence MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFESVCLEQPIGKKLFQQF
LQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAKLFCSFLDEGIVAKFKEGPVEIQDGLFQPLL
QATLAHLGQAPFQEYLGSLYFLRFLQWKWLEAQPMGEDWFLDFRVLGKGGFGEVSACQMKATGKLYACKKLNKKR
LKKRKGYQGAMVEKKILMKVHSRFIVSLAYAFETKADLCLVMTIMNGGDIRYHIYNVNEENPGFPEPRALFYTAQ
IICGLEHLHQRRIVYRDLKPENVLLDNDGNVRISDLGLAVELLDGQSKTKGYAGTPGFMAPELLQGEEYDFSVDY
FALGVTLYEMIAARGPFRARGEKVENKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLR
AHPLFKDLNWRQLEAGMLMPPFIPDSKTVYAKDIQDVGAFSTVKGVAFDKTDTEFFQEFATGNCPIPWQEEMIET
GIFGELNVWRSDGQMPDDMKGISGGSSSSSKSGMCLVS
Structural information
Protein Domains
(58..17-)
(/note="RGS-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00171-)
(190..45-)
(/note="Protein-kinase)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
(456..52-)
(/note="AGC-kinase-C-terminal")
Interpro:  IPR000961  IPR000239  IPR032965  IPR037716  IPR011009  
IPR000719  IPR017441  IPR016137  IPR036305  IPR008271  
Prosite:   PS51285 PS00107 PS50011 PS00108 PS50132
CDD:   cd05608

PDB:  
5AFP
PDBsum:   5AFP
STRING:   ENSP00000334876
Other Databases GeneCards:  GRK1  Malacards:  GRK1

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0050254 rhodopsin kinase activity
IDA molecular function
GO:0022400 regulation of rhodopsin m
ediated signaling pathway
IDA biological process
GO:0046777 protein autophosphorylati
on
IMP biological process
GO:0007165 signal transduction
IEA biological process
GO:0007601 visual perception
IEA biological process
GO:0004672 protein kinase activity
IEA molecular function
GO:0004674 protein serine/threonine
kinase activity
IEA molecular function
GO:0004703 G protein-coupled recepto
r kinase activity
IEA molecular function
GO:0005524 ATP binding
IEA molecular function
GO:0006468 protein phosphorylation
IEA biological process
GO:0022400 regulation of rhodopsin m
ediated signaling pathway
IEA biological process
GO:0050254 rhodopsin kinase activity
IEA molecular function
GO:0016740 transferase activity
IEA molecular function
GO:0016301 kinase activity
IEA molecular function
GO:0042995 cell projection
IEA cellular component
GO:0007601 visual perception
IEA biological process
GO:0050896 response to stimulus
IEA biological process
GO:0005524 ATP binding
IEA molecular function
GO:0000166 nucleotide binding
IEA molecular function
GO:0004674 protein serine/threonine
kinase activity
IEA molecular function
GO:0016020 membrane
IEA cellular component
GO:0016310 phosphorylation
IEA biological process
GO:0004672 protein kinase activity
TAS molecular function
GO:0004672 protein kinase activity
TAS molecular function
GO:0007601 visual perception
TAS biological process
GO:0008277 regulation of G protein-c
oupled receptor signaling
pathway
TAS biological process
GO:0016056 rhodopsin mediated signal
ing pathway
TAS biological process
GO:0016056 rhodopsin mediated signal
ing pathway
TAS biological process
GO:0050254 rhodopsin kinase activity
IEA molecular function
GO:0022400 regulation of rhodopsin m
ediated signaling pathway
TAS biological process
GO:0097381 photoreceptor disc membra
ne
TAS cellular component
GO:0001750 photoreceptor outer segme
nt
IEA cellular component
GO:0016020 membrane
IEA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04144Endocytosis
hsa04062Chemokine signaling pathway
hsa04744Phototransduction
Associated diseases References
Congenital stationary night blindness KEGG:H00787
Congenital stationary night blindness KEGG:H00787
Night blindness PMID:9020843
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract