• Gene id: 6004

Gene Summary

• Gene Symbol: RGS16   Gene   UCSC   Ensembl
• Aliases: A28-RGS14, A28-RGS14P, RGS-R
• Gene name: regulator of G protein signaling 16
• Alternate names: regulator of G-protein signaling 16, hRGS-r, regulator of G-protein signalling 16, retinal-specific RGS, retinally abundant regulator of G-protein signaling,
• Gene location: 1q25.3 (13915706: 13882041)     Exons: 4     NC_000018.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the 'regulator of G protein signaling' family. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in th
• OMIM: 602514

Protein Summary

• Protein general information: O15492  
  • Name: Regulator of G protein signaling 16 (RGS16) (A28 RGS14P) (Retinal specific RGS) (RGS r) (hRGS r) (Retinally abundant regulator of G protein signaling)
  • Length: 202  
  • Mass: 22749
  • Tissue specificity: Abundantly expressed in retina with lower levels of expression in most other tissues.
• Sequence:

  MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVLGWRESFDLLLSSKNG
  VAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETHELTRMNLQTATAT
  CFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT

• Structural information:
  • Protein Domains: (65..18-)
    (/note="RGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00171"-)
  • Interpro: IPR016137  IPR036305  IPR024066  
  • Prosite: PS50132
  • PDB: 2BT2 2IK8
  • PDBsum: 2BT2 2IK8
  • DIP: 59094
  • STRING: ENSP00000356529
• Other Databases: GeneCards:  RGS16  Malacards:  RGS16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IDA	cellular component
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0031224	intrinsic component of membrane	ISS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	ISS	biological process
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005516	calmodulin binding	TAS	molecular function
GO:0005096	GTPase activator activity	TAS	molecular function
GO:0007601	visual perception	TAS	biological process
GO:0008277	regulation of G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:0003924	GTPase activity	TAS	molecular function
GO:0031224	intrinsic component of membrane	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881