• Gene id: 6003

Gene Summary

• Gene Symbol: RGS13   Gene   UCSC   Ensembl
• Gene name: regulator of G protein signaling 13
• Alternate names: regulator of G-protein signaling 13, regulator of G-protein signalling 13,
• Gene location: 1q31.2 (192636146: 192660310)     Exons: 7     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the regulator of G protein signaling (RGS) family. RGS family members share similarity with S. cerevisiae SST2 and C. elegans egl-10 proteins, which contain a characteristic conserved RGS domain. RGS protein
• OMIM: 616288

Protein Summary

• Protein general information: O14921  
  • Name: Regulator of G protein signaling 13 (RGS13)
  • Length: 159  
  • Mass: 19135
• Sequence:

  MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETYKKIAS
  RWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLL
  KTMQSNNSF

• Structural information:
  • Protein Domains: (34..15-)
    (/note="RGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00171"-)
  • Interpro: IPR016137  IPR034954  IPR036305  IPR024066  
  • Prosite: PS50132
  • STRING: ENSP00000442837
• Other Databases: GeneCards:  RGS13  Malacards:  RGS13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045744	negative regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R