• Gene id: 6001

Gene Summary

• Gene Symbol: RGS10   Gene   UCSC   Ensembl
• Gene name: regulator of G protein signaling 10
• Alternate names: regulator of G-protein signaling 10, regulator of G-protein signalling 10,
• Gene location: 10q26.11 (119542718: 119499816)     Exons: 6     NC_000010.11
• Gene summary(Entrez): Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alph
• OMIM: 602856

Protein Summary

• Protein general information: O43665  
  • Name: Regulator of G protein signaling 10 (RGS10)
  • Length: 181  
  • Mass: 21210
• Sequence:

  MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACE
  DFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSD
  LFLKHKRTEEEEEDLPDAQTAAKRASRIYNT

• Structural information:
  • Protein Domains: (41..15-)
    (/note="RGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00171"-)
  • Interpro: IPR016137  IPR037879  IPR036305  IPR024066  
  • Prosite: PS50132
  • CDD: cd08741
  • PDB: 2DLR 2I59 2IHB
  • PDBsum: 2DLR 2I59 2IHB
  • DIP: 50368
  • STRING: ENSP00000358099
• Other Databases: GeneCards:  RGS10  Malacards:  RGS10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0007213	G protein-coupled acetylcholine receptor signaling pathway	IDA	biological process
GO:0001965	G-protein alpha-subunit binding	IPI	molecular function
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0001965	G-protein alpha-subunit binding	IEA	molecular function
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001975	response to amphetamine	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0043679	axon terminus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray