• Gene id: 60

Gene Summary

• Gene Symbol: ACTB   Gene   UCSC   Ensembl
• Aliases: BRWS1, PS1TP5BP1
• Gene name: actin beta
• Alternate names: actin, cytoplasmic 1, PS1TP5-binding protein 1, beta cytoskeletal actin,
• Gene location: 7p22.1 (5530708: 5527145)     Exons: 6     NC_000007.14
• Gene summary(Entrez): This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a major constituent of the contractile apparatus and
• OMIM: 102630

SNPs

rs11046992

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.23584632G>A
NC_000012.12   g.23584632G>C
NC_000012.12   g.23584632G>T
NC_000012.11   g.23737566G>A
NC_000012.11   g.23737566G>C
NC_000012.11   g.23737566G>T
NG_029612.2   g.982815C>T
NG_029612.2   g.982815C>G
NG_029612.2   g.982815C>A|SEQ=[G/A/C/T]|GE

rs10842262

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.24031610G>C
NC_000012.11   g.24184544G>C
NG_029612.2   g.535837C>G|SEQ=[G/C]|GENE=SOX5

rs10250822

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000007.14   g.17293365C>A
NC_000007.14   g.17293365C>G
NC_000007.14   g.17293365C>T
NC_000007.13   g.17332989C>A
NC_000007.13   g.17332989C>G
NC_000007.13   g.17332989C>T|SEQ=[C/A/G/T]|GENE=LOC101927609

rs10247158

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000007.14   g.17285544A>T
NC_000007.13   g.17325168A>T|SEQ=[A/T]|GENE=LOC101927609

rs2999052

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000003.12   g.128173194T>C
NC_000003.11   g.127892037T>C
NW_019805490.1   g.42304C>T|SEQ=[T/C]|GENE=EEFSEC

rs148454792

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000011.10   g.30233737C>A
NC_000011.9   g.30255284C>A
NG_008144.1   g.7722C>A
NM_000510.3   c.327C>A
NM_000510.2   c.327C>A
NM_001018080.2   c.327C>A
NM_001018080.1   c.327C>A
NP_000501.1   p.Ser109Arg
NP_001018090.1   p.Ser109Arg|SEQ=[C/A]|GENE=FSHB
LOC105376  

rs6170

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000011.10   g.30231961G>T
NC_000011.9   g.30253508G>T
NG_008144.1   g.5946G>T
NM_000510.3   c.59G>T
NM_000510.2   c.59G>T
NM_001018080.2   c.59G>T
NM_001018080.1   c.59G>T
NP_000501.1   p.Ser20Ile
NP_001018090.1   p.Ser20Ile|SEQ=[G/T]|GENE=FSHB
LOC105376607   10

rs146039840

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.23949682T>G
NC_000012.11   g.24102616T>G
NG_029612.2   g.617765A>C
NM_001330785.1   c.-81A>C|SEQ=[T/G]|GENE=SOX5

rs10249788

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000007.14   g.17298523C>G
NC_000007.14   g.17298523C>T
NC_000007.13   g.17338147C>G
NC_000007.13   g.17338147C>T
XR_927073.2   n.16G>C
XR_927073.2   n.16G>A|SEQ=[C/G/T]|GENE=AHR
LOC101927609   101927609

rs3757824

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000007.14   g.17296411T>C
NC_000007.14   g.17296411T>G
NC_000007.13   g.17336035T>C
NC_000007.13   g.17336035T>G|SEQ=[T/C/G]|GENE=LOC101927609

rs2241057

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000002.12   g.72134831A>G
NC_000002.11   g.72361960A>G
NG_007957.1   g.18004T>C
NM_019885.3   c.791T>C
NM_001277742.1   c.566T>C
XM_005264433.4   c.617T>C
XM_005264433.1   c.617T>C
XM_011532988.1   c.218T>C
NP_063938.1   p.Leu264Ser
NP_001264671.1   p.Leu189Ser
XP_00  

rs707718

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000002.12   g.72129320G>C
NC_000002.12   g.72129320G>T
NC_000002.11   g.72356449G>C
NC_000002.11   g.72356449G>T
NG_007957.1   g.23515C>G
NG_007957.1   g.23515C>A
NM_019885.3   c.*2907C>G
NM_019885.3   c.*2907C>A
NM_001277742.1   c.*2907C>G
NM_001277742.1   c.*2907C>

Protein Summary

• Protein general information: P60709  
  • Name: Actin, cytoplasmic 1 (Beta actin) [Cleaved into: Actin, cytoplasmic 1, N terminally processed]
  • Length: 375  
  • Mass: 41,737
• Sequence:

  MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI
  VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTG
  IVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQ
  EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
  GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

• Structural information:
  • Interpro: IPR004000  IPR020902  IPR004001  
  • Prosite: PS00406 PS00432 PS01132
  • PDB: 3BYH 3D2U 3J82 3LUE 6ANU
  • PDBsum: 3BYH 3D2U 3J82 3LUE 6ANU
  • DIP: 29686
  • STRING: ENSP00000349960
• Other Databases: GeneCards:  ACTB  Malacards:  ACTB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0001895	retina homeostasis	IEP	biological process
GO:0005200	structural constituent of cytoskeleton	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	ISS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0019894	kinesin binding	IPI	molecular function
GO:0021762	substantia nigra development	IEP	biological process
GO:0030529	intracellular ribonucleoprotein complex	IDA	cellular component
GO:0030957	Tat protein binding	IPI	molecular function
GO:0034329	cell junction assembly	TAS	biological process
GO:0035267	NuA4 histone acetyltransferase complex	IDA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043044	ATP-dependent chromatin remodeling	IDA	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0045815	positive regulation of gene expression, epigenetic	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0050998	nitric-oxide synthase binding	IPI	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070527	platelet aggregation	IMP	biological process
GO:0070688	MLL5-L complex	IDA	cellular component
GO:0072562	blood microparticle	IDA	cellular component
GO:0097433	dense body	ISS	cellular component
GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	IDA	molecular function
GO:0000980	RNA polymerase II distal enhancer sequence-specific DNA binding	IDA	molecular function
GO:0031492	nucleosomal DNA binding	IDA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0001895	retina homeostasis	IEP	biological process
GO:0005200	structural constituent of cytoskeleton	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	ISS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0019894	kinesin binding	IPI	molecular function
GO:0021762	substantia nigra development	IEP	biological process
GO:0030529	intracellular ribonucleoprotein complex	IDA	cellular component
GO:0030957	Tat protein binding	IPI	molecular function
GO:0034329	cell junction assembly	TAS	biological process
GO:0035267	NuA4 histone acetyltransferase complex	IDA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043044	ATP-dependent chromatin remodeling	IDA	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0045815	positive regulation of gene expression, epigenetic	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0050998	nitric-oxide synthase binding	IPI	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070527	platelet aggregation	IMP	biological process
GO:0070688	MLL5-L complex	IDA	cellular component
GO:0072562	blood microparticle	IDA	cellular component
GO:0097433	dense body	ISS	cellular component
GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	IDA	molecular function
GO:0000980	RNA polymerase II distal enhancer sequence-specific DNA binding	IDA	molecular function
GO:0031492	nucleosomal DNA binding	IDA	molecular function
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0001895	retina homeostasis	IEP	biological process
GO:0005200	structural constituent of cytoskeleton	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	ISS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0019894	kinesin binding	IPI	molecular function
GO:0021762	substantia nigra development	IEP	biological process
GO:0030529	intracellular ribonucleoprotein complex	IDA	cellular component
GO:0030957	Tat protein binding	IPI	molecular function
GO:0034329	cell junction assembly	TAS	biological process
GO:0035267	NuA4 histone acetyltransferase complex	IDA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043044	ATP-dependent chromatin remodeling	IDA	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0045815	positive regulation of gene expression, epigenetic	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0050998	nitric-oxide synthase binding	IPI	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070527	platelet aggregation	IMP	biological process
GO:0070688	MLL5-L complex	IDA	cellular component
GO:0072562	blood microparticle	IDA	cellular component
GO:0097433	dense body	ISS	cellular component
GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	IDA	molecular function
GO:0000980	RNA polymerase II distal enhancer sequence-specific DNA binding	IDA	molecular function
GO:0031492	nucleosomal DNA binding	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04145	Phagosome
hsa04210	Apoptosis
hsa04510	Focal adhesion
hsa04520	Adherens junction
hsa04530	Tight junction
hsa04810	Regulation of actin cytoskeleton
hsa04611	Platelet activation
hsa04670	Leukocyte transendothelial migration
hsa04921	Oxytocin signaling pathway
hsa04919	Thyroid hormone signaling pathway
hsa04971	Gastric acid secretion
hsa04714	Thermogenesis
hsa05205	Proteoglycans in cancer
hsa05225	Hepatocellular carcinoma
hsa05418	Fluid shear stress and atherosclerosis
hsa05410	Hypertrophic cardiomyopathy
hsa05412	Arrhythmogenic right ventricular cardiomyopathy
hsa05414	Dilated cardiomyopathy
hsa05416	Viral myocarditis
hsa05110	Vibrio cholerae infection
hsa05130	Pathogenic Escherichia coli infection
hsa05132	Salmonella infection
hsa05131	Shigellosis
hsa05135	Yersinia infection
hsa05100	Bacterial invasion of epithelial cells
hsa05164	Influenza A

Diseases

Associated diseases	References
Cancer (breast)	GAD: 19538885
Dystonia	OMIM: 102630
Endometriosis	INFBASE: 16750201
Female infertility	INFBASE: 21890413
Premature ovarian failure (POF)	INFBASE: 21890413
Polycystic ovary syndrome (PCOS)	INFBASE: 22052386
Male factor infertility	MIK: 23174138
Spermatogenesis defects	MIK: 3285991
Spermatogenesis defects	MIK: 3285991
Asthenozoospermia	MIK: 23174138
Baraitser-Winter syndrome 1	OMIM: 102630
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Idiopathic asthenozoospermia	MIK: 23174138
Male infertility	MIK: 23174138
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23174138	Idiopathic asthenozoospermia, male infertility			46 (25 infertile patients affected by idiopathic asthenozoospermia, 21 age-matched normospermic fertile donors)	Male infertility	Ezrin  Cdc42 CD9 F-actin and ?-tubulin
3285991	Male infertility, spermatozoa structure				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881