• Gene id: 5997

Gene Summary

• Gene Symbol: RGS2   Gene   UCSC   Ensembl
• Aliases: G0S8
• Gene name: regulator of G protein signaling 2
• Alternate names: regulator of G-protein signaling 2, G0 to G1 switch regulatory 8, 24kD, G0/G1 switch regulatory protein 8, cell growth-inhibiting gene 31 protein, cell growth-inhibiting protein 31, regulator of G-protein signaling 2, 24kDa,
• Gene location: 1q31.2 (192809038: 192812274)     Exons: 9     NC_000001.11
• Gene summary(Entrez): Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alph
• OMIM: 600861

Protein Summary

• Protein general information: P41220  
  • Name: Regulator of G protein signaling 2 (RGS2) (Cell growth inhibiting gene 31 protein) (G0/G1 switch regulatory protein 8)
  • Length: 211  
  • Mass: 24382
  • Tissue specificity: Expressed in acute myelogenous leukemia (AML) and in acute lymphoblastic leukemia (ALL). {ECO
• Sequence:

  MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKTGKKSKQQAFIKPSPE
  EAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFIEKEAPKEINI
  DFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHAT

• Structural information:
  • Protein Domains: (83..19-)
    (/note="RGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00171"-)
  • Interpro: IPR016137  IPR034947  IPR036305  IPR024066  
  • Prosite: PS50132
  • PDB: 2AF0 2V4Z 4EKC 4EKD
  • PDBsum: 2AF0 2V4Z 4EKC 4EKD
  • DIP: 44289
  • STRING: ENSP00000235382
• Other Databases: GeneCards:  RGS2  Malacards:  RGS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0045744	negative regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005516	calmodulin binding	TAS	molecular function
GO:0005096	GTPase activator activity	TAS	molecular function
GO:0008277	regulation of G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0007283	spermatogenesis	IEA	biological process
GO:0009898	cytoplasmic side of plasma membrane	IEA	cellular component
GO:0045744	negative regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0050873	brown fat cell differentiation	IEA	biological process
GO:0060087	relaxation of vascular smooth muscle	IEA	biological process
GO:0140194	negative regulation of adenylate cyclase-inhibiting adrenergic receptor signaling pathway involved in heart process	IEA	biological process
GO:0001975	response to amphetamine	IEA	biological process
GO:0009898	cytoplasmic side of plasma membrane	IEA	cellular component
GO:0017148	negative regulation of translation	IEA	biological process
GO:0030728	ovulation	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0045471	response to ethanol	IEA	biological process
GO:0045744	negative regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0060135	maternal process involved in female pregnancy	IEA	biological process
GO:1900924	negative regulation of glycine import across plasma membrane	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0010519	negative regulation of phospholipase activity	IEA	biological process
GO:0010614	negative regulation of cardiac muscle hypertrophy	IEA	biological process
GO:0043407	negative regulation of MAP kinase activity	IEA	biological process
GO:0043951	negative regulation of cAMP-mediated signaling	IEA	biological process
GO:0055119	relaxation of cardiac muscle	IEA	biological process
GO:0060452	positive regulation of cardiac muscle contraction	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007420	brain development	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0048487	beta-tubulin binding	IEA	molecular function
GO:0061052	negative regulation of cell growth involved in cardiac muscle cell development	IEA	biological process
GO:0005829	cytosol	ISS	cellular component
GO:0009898	cytoplasmic side of plasma membrane	ISS	cellular component
GO:0045744	negative regulation of G protein-coupled receptor signaling pathway	ISS	biological process
GO:0140194	negative regulation of adenylate cyclase-inhibiting adrenergic receptor signaling pathway involved in heart process	ISS	biological process
GO:0010519	negative regulation of phospholipase activity	ISS	biological process
GO:0010614	negative regulation of cardiac muscle hypertrophy	ISS	biological process
GO:0043407	negative regulation of MAP kinase activity	ISS	biological process
GO:0055119	relaxation of cardiac muscle	ISS	biological process
GO:0060452	positive regulation of cardiac muscle contraction	ISS	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005096	GTPase activator activity	IMP	molecular function
GO:0001965	G-protein alpha-subunit binding	IPI	molecular function
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04022	cGMP-PKG signaling pathway
hsa04740	Olfactory transduction
hsa04921	Oxytocin signaling pathway
P06959	CCKR signaling map

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881