• Gene id: 5996

Gene Summary

• Gene Symbol: RGS1   Gene   UCSC   Ensembl
• Aliases: 1R20, BL34, HEL-S-87, IER1, IR20
• Gene name: regulator of G protein signaling 1
• Alternate names: regulator of G-protein signaling 1, B-cell activation protein BL34, early response protein 1R20, epididymis secretory protein Li 87, immediate-early response 1, B-cell specific, regulator of G-protein signalling 1,
• Gene location: 1q31.2 (192575772: 192580023)     Exons: 5     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the regulator of G-protein signalling family. This protein is located on the cytosolic side of the plasma membrane and contains a conserved, 120 amino acid motif called the RGS domain. The protein attenuates the signalling ac
• OMIM: 600323

Protein Summary

• Protein general information: Q08116  
  • Name: Regulator of G protein signaling 1 (RGS1) (B cell activation protein BL34) (Early response protein 1R20)
  • Length: 209  
  • Mass: 23858
  • Tissue specificity: Detected in peripheral blood monocytes (PubMed
• Sequence:

  MRAAAISTPKLDKMPGMFFSANPKELKGTTHSLLDDKMQKRRPKTFGMDMKAYLRSMIPHLESGMKSSKSKDVLS
  AAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTESDLLPCKAEEIYKAFVHSDAAKQIN
  IDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQANSLK

• Structural information:
  • Protein Domains: (85..20-)
    (/note="RGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00171"-)
  • Interpro: IPR016137  IPR030409  IPR036305  IPR024066  
  • Prosite: PS50132
  • PDB: 2BV1 2GTP
  • PDBsum: 2BV1 2GTP
  • DIP: 59091
  • STRING: ENSP00000356429
• Other Databases: GeneCards:  RGS1  Malacards:  RGS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0061737	leukotriene signaling pathway	IDA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IDA	cellular component
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0001965	G-protein alpha-subunit binding	IPI	molecular function
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005096	GTPase activator activity	TAS	molecular function
GO:0005516	calmodulin binding	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:0009617	response to bacterium	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospadias	MIK: 24778562
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
24778562	Hypospadias			13 (5 controls, 8 cases)	Male infertility	Microarray