• Gene id: 599

Gene Summary

• Gene Symbol: BCL2L2   Gene   UCSC   Ensembl
• Aliases: BCL-W, BCL2-L-2, BCLW, PPP1R51
• Gene name: BCL2 like 2
• Alternate names: bcl-2-like protein 2, apoptosis regulator BCL-W, protein phosphatase 1, regulatory subunit 51,
• Gene location: 14q11.2 (23306761: 23311758)     Exons: 4     NC_000014.9
• Gene summary(Entrez): This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cyt
• OMIM: 601931

Protein Summary

• Protein general information: Q92843  
  • Name: Bcl 2 like protein 2 (Bcl2 L 2) (Apoptosis regulator Bcl W)
  • Length: 193  
  • Mass: 20,746
  • Tissue specificity: Highly expressed in pituitary. Also expressed at lower levels in adult brain, kidney, liver, lung, pancreas, placenta and skeletal muscle. Not expressed in brain. In the pituitary, highly expressed in anterior gland cells. {ECO
• Sequence:

  MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSA
  QQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTAL
  YGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK

• Structural information:
  • Interpro: IPR013280  IPR002475  IPR020717  IPR020726  IPR003093   IPR020731  IPR036834  IPR026298  
  • Prosite: PS50062 PS01080 PS01258 PS01260 PS50063
  • PDB: 1MK3 1O0L 1ZY3 2Y6W 4CIM
  • PDBsum: 1MK3 1O0L 1ZY3 2Y6W 4CIM
  • DIP: 33700
  • STRING: ENSP00000250405
• Other Databases: GeneCards:  BCL2L2  Malacards:  BCL2L2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005741	mitochondrial outer membrane	IBA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0007283	spermatogenesis	TAS	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IBA	biological process
GO:0042803	protein homodimerization activity	IBA	molecular function
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0046982	protein heterodimerization activity	IBA	molecular function
GO:0051400	BH domain binding	IEA	molecular function
GO:0060011	Sertoli cell proliferation	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IBA	biological process
GO:2001243	negative regulation of intrinsic apoptotic signaling pathway	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IBA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0007283	spermatogenesis	TAS	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0042803	protein homodimerization activity	IBA	molecular function
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0046982	protein heterodimerization activity	IBA	molecular function
GO:0051400	BH domain binding	IEA	molecular function
GO:0060011	Sertoli cell proliferation	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IBA	biological process
GO:2001243	negative regulation of intrinsic apoptotic signaling pathway	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005741	mitochondrial outer membrane	IBA	cellular component
GO:0007283	spermatogenesis	TAS	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IBA	biological process
GO:0042803	protein homodimerization activity	IBA	molecular function
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0046982	protein heterodimerization activity	IBA	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IBA	biological process
GO:2001243	negative regulation of intrinsic apoptotic signaling pathway	IBA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer

Diseases

Associated diseases	References
Cancer (head and neck)	GAD: 20819778
Non obstructive azoospermia	MIK: 26056927
Male factor infertility	MIK: 26056927
Azoospermia	MIK: 26056927
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Azoospermia	MIK: 26056927
Male infertility	MIK: 26056927
Nonobstructive azoospermia, Male infertility	MIK: 26056927
Required for normal testicular development and spermatogenesis	MIK: 12808071
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26056927	Nonobstructive azoospermia, Male infertility			63 (16 obstructive azoospermia, 11 hypospermatogenesis, 15 maturation arrest, 21 Sertoli cell only)	Male infertility	BAX BAK BCL2 and BCLW
12808071	Required for normal testicular development and spermatogenesis				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray