About Us

Search Result


Gene id 5983
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol RFC3   Gene   UCSC   Ensembl
Aliases RFC38
Gene name replication factor C subunit 3
Alternate names replication factor C subunit 3, A1 38 kDa subunit, RF-C 38 kDa subunit, RFC, 38 kD subunit, activator 1 38 kDa subunit, activator 1 subunit 3, replication factor C (activator 1) 3, 38kDa, replication factor C 38 kDa subunit,
Gene location 13q13.2 (33818068: 33973945)     Exons: 15     NC_000013.11
Gene summary(Entrez) The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consistin
OMIM 600405

Protein Summary

Protein general information P40938  

Name: Replication factor C subunit 3 (Activator 1 38 kDa subunit) (A1 38 kDa subunit) (Activator 1 subunit 3) (Replication factor C 38 kDa subunit) (RF C 38 kDa subunit) (RFC38)

Length: 356  Mass: 40556

Sequence MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTIT
TPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRR
TMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRK
ALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELL
HNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF
Structural information
Interpro:  IPR003593  IPR008921  IPR027417  

DIP:  

36432

MINT:  
STRING:   ENSP00000369411
Other Databases GeneCards:  RFC3  Malacards:  RFC3

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0003689 DNA clamp loader activity
IBA contributes to
GO:0005634 nucleus
IBA cellular component
GO:0006261 DNA-dependent DNA replica
tion
IBA biological process
GO:0005663 DNA replication factor C
complex
IBA cellular component
GO:0006281 DNA repair
IBA biological process
GO:0017116 single-stranded DNA helic
ase activity
IDA contributes to
GO:1900264 positive regulation of DN
A-directed DNA polymerase
activity
IDA biological process
GO:0003689 DNA clamp loader activity
IDA contributes to
GO:0031390 Ctf18 RFC-like complex
IDA cellular component
GO:0006260 DNA replication
IEA biological process
GO:0003677 DNA binding
IEA molecular function
GO:0006260 DNA replication
IEA biological process
GO:0005634 nucleus
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0006271 DNA strand elongation inv
olved in DNA replication
TAS biological process
GO:0006283 transcription-coupled nuc
leotide-excision repair
TAS biological process
GO:0033683 nucleotide-excision repai
r, DNA incision
TAS biological process
GO:0042276 error-prone translesion s
ynthesis
TAS biological process
GO:0042276 error-prone translesion s
ynthesis
TAS biological process
GO:0042276 error-prone translesion s
ynthesis
TAS biological process
GO:1901796 regulation of signal tran
sduction by p53 class med
iator
TAS biological process
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0006260 DNA replication
TAS biological process
GO:0006260 DNA replication
TAS biological process
GO:0006260 DNA replication
TAS biological process
GO:0006296 nucleotide-excision repai
r, DNA incision, 5'-to le
sion
TAS biological process
GO:0006297 nucleotide-excision repai
r, DNA gap filling
TAS biological process
GO:0019985 translesion synthesis
TAS biological process
GO:0032201 telomere maintenance via
semi-conservative replica
tion
TAS biological process
GO:0032201 telomere maintenance via
semi-conservative replica
tion
TAS biological process
GO:0032201 telomere maintenance via
semi-conservative replica
tion
TAS biological process
GO:0042769 DNA damage response, dete
ction of DNA damage
TAS biological process
GO:0070987 error-free translesion sy
nthesis
TAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005634 nucleus
IEA cellular component
GO:0032508 DNA duplex unwinding
IEA biological process
GO:0006260 DNA replication
IDA biological process
GO:0016887 ATPase activity
IDA contributes to
GO:0003677 DNA binding
IDA contributes to
GO:0005663 DNA replication factor C
complex
IDA cellular component
GO:0005663 DNA replication factor C
complex
TAS cellular component
GO:0000731 DNA synthesis involved in
DNA repair
TAS biological process
GO:0003689 DNA clamp loader activity
TAS molecular function
GO:0046683 response to organophospho
rus
IEP biological process
GO:0005515 protein binding
IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa03420Nucleotide excision repair
hsa03030DNA replication
hsa03430Mismatch repair
Associated diseases References
Teratozoospermia MIK: 17327269
Unexplained infertility MIK: 25753583

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
25753583 Unexplaine
d infertil
ity

46 (17 fertile
men, 29 male pa
tients)
Male infertility Microarray
Show abstract