• Gene id: 5977

Gene Summary

• Gene Symbol: DPF2   Gene   UCSC   Ensembl
• Aliases: CSS7, REQ, UBID4, ubi-d4
• Gene name: double PHD fingers 2
• Alternate names: zinc finger protein ubi-d4, BAF45D, BRG1-associated factor 45D, D4, zinc and double PHD fingers family 2, apoptosis response zinc finger protein, protein requiem, requiem, apoptosis response zinc finger,
• Gene location: 11q13.1 (65333839: 65354261)     Exons: 12     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival fa

Protein Summary

• Protein general information: Q92785  
  • Name: Zinc finger protein ubi d4 (Apoptosis response zinc finger protein) (BRG1 associated factor 45D) (BAF45D) (D4, zinc and double PHD fingers family 2) (Protein requiem)
  • Length: 391  
  • Mass: 44155
  • Tissue specificity: Ubiquitous.
• Sequence:

  MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLASGQLYSYP
  ARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTN
  SRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGSARKKLDASILEDRDKPYACDICGKRYKNRPGLS
  YHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGR
  SGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCL
  DLLKEKASIYQNQNSS

• Structural information:
  • Interpro: IPR025750  IPR036236  IPR013087  IPR011011  IPR001965   IPR019787  IPR013083  
  • Prosite: PS01359 PS50016 PS00028 PS50157
  • PDB: 3IUF 5B79 5VDC
  • PDBsum: 3IUF 5B79 5VDC
  • DIP: 27575
  • STRING: ENSP00000436901
• Other Databases: GeneCards:  DPF2  Malacards:  DPF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0070577	lysine-acetylated histone binding	IDA	molecular function
GO:0003714	transcription corepressor activity	TAS	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	TAS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0042393	histone binding	IBA	molecular function
GO:0004402	histone acetyltransferase activity	IBA	molecular function
GO:0071565	nBAF complex	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0007399	nervous system development	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0000123	histone acetyltransferase complex	IBA	cellular component
GO:0070577	lysine-acetylated histone binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0062072	H3K9me3 modified histone binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1905454	negative regulation of myeloid progenitor cell differentiation	IMP	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016573	histone acetylation	IEA	biological process
GO:0000790	nuclear chromatin	HDA	cellular component
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	HDA	molecular function

Diseases

Associated diseases	References
Coffin-Siris syndrome	KEGG:H01403
Coffin-Siris syndrome	KEGG:H01403
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray