• Gene id: 5970

Gene Summary

• Gene Symbol: RELA   Gene   UCSC   Ensembl
• Aliases: CMCU, NFKB3, p65
• Gene name: RELA proto-oncogene, NF-kB subunit
• Alternate names: transcription factor p65, NF-kappa-B p65delta3, NF-kappa-B transcription factor p65, nuclear factor NF-kappa-B p65 subunit, nuclear factor of kappa light polypeptide gene enhancer in B-cells 3, v-rel avian reticuloendotheliosis viral oncogene homolog A, v-rel r,
• Gene location: 11q13.1 (65662971: 65653595)     Exons: 12     NC_000011.10
• Gene summary(Entrez): NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcripti
• OMIM: 164014

Protein Summary

• Protein general information: Q04206  
  • Name: Transcription factor p65 (Nuclear factor NF kappa B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B cells 3)
  • Length: 551  
  • Mass: 60219
• Sequence:

  MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRIS
  LVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRG
  DYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIE
  VYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
  KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQ
  ASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDL
  GALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPN
  GLLSGDEDFSSIADMDFSALLSQISS

• Structural information:
  • Protein Domains: (19..30-)
    (/note="RHD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00265"-)
  • Interpro: IPR013783  IPR014756  IPR002909  IPR033926  IPR000451   IPR008967  IPR030495  IPR030492  IPR032397  IPR011539  IPR037059  
  • Prosite: PS01204 PS50254
  • CDD: cd01177
  • PDB: 1NFI 2LSP 2O61 3GUT 3QXY 3RC0 4KV1 4KV4 5U4K 5URN
  • PDBsum: 1NFI 2LSP 2O61 3GUT 3QXY 3RC0 4KV1 4KV4 5U4K 5URN
  • DIP: 24238
  • STRING: ENSP00000384273
• Other Databases: GeneCards:  RELA  Malacards:  RELA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000790	nuclear chromatin	IDA	is active in
GO:0005634	nucleus	IDA	cellular component
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding	IDA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0001225	RNA polymerase II transcription coactivator binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:1904996	positive regulation of leukocyte adhesion to vascular endothelial cell	IMP	biological process
GO:0045416	positive regulation of interleukin-8 biosynthetic process	IGI	biological process
GO:1902004	positive regulation of amyloid-beta formation	ISS	biological process
GO:0000790	nuclear chromatin	IGI	cellular component
GO:0005737	cytoplasm	IGI	cellular component
GO:0071222	cellular response to lipopolysaccharide	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IGI	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IGI	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0045087	innate immune response	IBA	biological process
GO:0034097	response to cytokine	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0005654	nucleoplasm	IBA	cellular component
GO:0003682	chromatin binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0038061	NIK/NF-kappaB signaling	IBA	biological process
GO:0033256	I-kappaB/NF-kappaB complex	IBA	cellular component
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0071356	cellular response to tumor necrosis factor	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0003682	chromatin binding	IDA	molecular function
GO:0070301	cellular response to hydrogen peroxide	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003677	DNA binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0050727	regulation of inflammatory response	ISS	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0042025	host cell nucleus	IEA	cellular component
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0071159	NF-kappaB complex	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0070431	nucleotide-binding oligomerization domain containing 2 signaling pathway	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003677	DNA binding	IDA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0031293	membrane protein intracellular domain proteolysis	TAS	biological process
GO:0032481	positive regulation of type I interferon production	TAS	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0070498	interleukin-1-mediated signaling pathway	TAS	biological process
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0006117	acetaldehyde metabolic process	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0010033	response to organic substance	IEA	biological process
GO:0014040	positive regulation of Schwann cell differentiation	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0032570	response to progesterone	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0034097	response to cytokine	IEA	biological process
GO:0043278	response to morphine	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0001942	hair follicle development	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0006325	chromatin organization	IEA	biological process
GO:0006952	defense response	IEA	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0009887	animal organ morphogenesis	IEA	biological process
GO:0035729	cellular response to hepatocyte growth factor stimulus	IEA	biological process
GO:0035994	response to muscle stretch	IEA	biological process
GO:0042177	negative regulation of protein catabolic process	IEA	biological process
GO:0042805	actinin binding	IEA	molecular function
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0045084	positive regulation of interleukin-12 biosynthetic process	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0050727	regulation of inflammatory response	IEA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0071532	ankyrin repeat binding	IEA	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0099527	postsynapse to nucleus signaling pathway	IEA	biological process
GO:0000790	nuclear chromatin	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008134	transcription factor binding	IEA	molecular function
GO:0010035	response to inorganic substance	IEA	biological process
GO:0032332	positive regulation of chondrocyte differentiation	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0033590	response to cobalamin	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0043200	response to amino acid	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0046627	negative regulation of insulin receptor signaling pathway	IEA	biological process
GO:0051591	response to cAMP	IEA	biological process
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0000790	nuclear chromatin	IEA	cellular component
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0001889	liver development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0019899	enzyme binding	IEA	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0032495	response to muramyl dipeptide	IEA	biological process
GO:0033234	negative regulation of protein sumoylation	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IEA	biological process
GO:1902894	negative regulation of pri-miRNA transcription by RNA polymerase II	IMP	biological process
GO:0071356	cellular response to tumor necrosis factor	IMP	biological process
GO:0033613	activating transcription factor binding	IPI	molecular function
GO:0070491	repressing transcription factor binding	IPI	molecular function
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IMP	biological process
GO:0070555	response to interleukin-1	IGI	biological process
GO:0071316	cellular response to nicotine	IMP	biological process
GO:2000630	positive regulation of miRNA metabolic process	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0071354	cellular response to interleukin-6	IMP	biological process
GO:1904385	cellular response to angiotensin	IMP	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IMP	biological process
GO:0070498	interleukin-1-mediated signaling pathway	IGI	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0005634	nucleus	IGI	cellular component
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	IMP	biological process
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:1901224	positive regulation of NIK/NF-kappaB signaling	IDA	biological process
GO:1901222	regulation of NIK/NF-kappaB signaling	IGI	biological process
GO:1901224	positive regulation of NIK/NF-kappaB signaling	IMP	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IMP	biological process
GO:0003700	DNA-binding transcription factor activity	IMP	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IMP	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IMP	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0005730	nucleolus	IDA	NOT|cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0050862	positive regulation of T cell receptor signaling pathway	IMP	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IGI	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0071356	cellular response to tumor necrosis factor	IMP	biological process
GO:0035525	NF-kappaB p50/p65 complex	IDA	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042277	peptide binding	IPI	molecular function
GO:0071356	cellular response to tumor necrosis factor	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0042301	phosphate ion binding	IDA	molecular function
GO:0019221	cytokine-mediated signaling pathway	IDA	biological process
GO:0010033	response to organic substance	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0010224	response to UV-B	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003677	DNA binding	IDA	molecular function
GO:0031490	chromatin DNA binding	IDA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	IDA	biological process
GO:0071347	cellular response to interleukin-1	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0042802	identical protein binding	IDA	molecular function
GO:0006954	inflammatory response	IDA	biological process
GO:0005667	transcription regulator complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0051607	defense response to virus	NAS	biological process
GO:0042805	actinin binding	IPI	molecular function
GO:0051059	NF-kappaB binding	IPI	molecular function
GO:0051059	NF-kappaB binding	IPI	molecular function
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0006968	cellular defense response	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071223	cellular response to lipoteichoic acid	IMP	biological process
GO:1901223	negative regulation of NIK/NF-kappaB signaling	IMP	biological process
GO:0003677	DNA binding	IMP	molecular function
GO:0071224	cellular response to peptidoglycan	IMP	biological process
GO:0043620	regulation of DNA-templated transcription in response to stress	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1901522	positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05168	Herpes simplex virus 1 infection
hsa05010	Alzheimer disease
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04010	MAPK signaling pathway
hsa05131	Shigellosis
hsa04014	Ras signaling pathway
hsa05132	Salmonella infection
hsa04024	cAMP signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa05130	Pathogenic Escherichia coli infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05203	Viral carcinogenesis
hsa05169	Epstein-Barr virus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04621	NOD-like receptor signaling pathway
hsa05202	Transcriptional misregulation in cancer
hsa05152	Tuberculosis
hsa04932	Non-alcoholic fatty liver disease
hsa05164	Influenza A
hsa04218	Cellular senescence
hsa05161	Hepatitis B
hsa04380	Osteoclast differentiation
hsa05160	Hepatitis C
hsa05418	Fluid shear stress and atherosclerosis
hsa05135	Yersinia infection
hsa04210	Apoptosis
hsa04926	Relaxin signaling pathway
hsa04722	Neurotrophin signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa05162	Measles
hsa04668	TNF signaling pathway
hsa04064	NF-kappa B signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04931	Insulin resistance
hsa04659	Th17 cell differentiation
hsa04620	Toll-like receptor signaling pathway
hsa04066	HIF-1 signaling pathway
hsa05145	Toxoplasmosis
hsa04662	B cell receptor signaling pathway
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05142	Chagas disease
hsa04658	Th1 and Th2 cell differentiation
hsa05222	Small cell lung cancer
hsa04211	Longevity regulating pathway
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa05146	Amoebiasis
hsa04657	IL-17 signaling pathway
hsa04137	Mitophagy - animal
hsa05220	Chronic myeloid leukemia
hsa05215	Prostate cancer
hsa05120	Epithelial cell signaling in Helicobacter pylori infection
hsa04622	RIG-I-like receptor signaling pathway
hsa04920	Adipocytokine signaling pathway
hsa05212	Pancreatic cancer
hsa05133	Pertussis
hsa04917	Prolactin signaling pathway
hsa05221	Acute myeloid leukemia
hsa05140	Leishmaniasis
hsa04623	Cytosolic DNA-sensing pathway
hsa05030	Cocaine addiction
hsa05134	Legionellosis
hsa05321	Inflammatory bowel disease
hsa01523	Antifolate resistance

Diseases

Associated diseases	References
Sleep apnea	PMID:17013605
Lymphoma	PMID:9047386
Ductal carcinoma in situ	PMID:17375183
Otitis media	PMID:24690988
Cholesteatoma of middle ear	PMID:24690988
urinary bladder cancer	PMID:18188593
Prostatic hypertrophy	PMID:25546515
pancreatic cancer	PMID:9918209
prostate adenocarcinoma	PMID:15073126
lung non-small cell carcinoma	PMID:16287968
renal cell carcinoma	PMID:12663495
renal cell carcinoma	PMID:17290398
prostate carcinoma in situ	PMID:16278667
cervix uteri carcinoma in situ	PMID:16850495
obesity	PMID:18356846
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881