• Gene id: 5968

Gene Summary

• Gene Symbol: REG1B   Gene   UCSC   Ensembl
• Aliases: PSPS2, REGH, REGI-BETA, REGL
• Gene name: regenerating family member 1 beta
• Alternate names: lithostathine-1-beta, PSP-2, REG-1-beta, pancreatic stone protein 2, regenerating islet-derived 1 beta (pancreatic stone protein, pancreatic thread protein), regenerating islet-derived protein 1-beta, regenerating protein I beta, secretory pancreatic stone prote,
• Gene location: 2p12 (68844409: 68754619)     Exons: 22     NC_000011.10
• Gene summary(Entrez): This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV based on the primary structures of the encoded proteins. This gene encodes a protein secreted by
• OMIM: 167771

Protein Summary

• Protein general information: P48304  
  • Name: Lithostathine 1 beta (Pancreatic stone protein 2) (PSP 2) (Regenerating islet derived protein 1 beta) (REG 1 beta) (Regenerating protein I beta)
  • Length: 166  
  • Mass: 18665
• Sequence:

  MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSV
  LTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDTGSPSSANAGYCASLTSCSGFKKWK
  DESCEKKFSFVCKFKN

• Structural information:
  • Protein Domains: (34..16-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR018378  IPR016187  
  • Prosite: PS00615 PS50041
  • STRING: ENSP00000303206
• Other Databases: GeneCards:  REG1B  Malacards:  REG1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IBA	biological process
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0008284	positive regulation of cell population proliferation	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0070492	oligosaccharide binding	IBA	molecular function
GO:0044278	cell wall disruption in other organism	IBA	biological process
GO:0043434	response to peptide hormone	IBA	biological process
GO:0042834	peptidoglycan binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881