• Gene id: 5962

Gene Summary

• Gene Symbol: RDX   Gene   UCSC   Ensembl
• Aliases: DFNB24
• Gene name: radixin
• Alternate names: radixin,
• Gene location: 11q22.3 (110296711: 110174879)     Exons: 17     NC_000011.10
• Gene summary(Entrez): Radixin is a cytoskeletal protein that may be important in linking actin to the plasma membrane. It is highly similar in sequence to both ezrin and moesin. The radixin gene has been localized by fluorescence in situ hybridization to 11q23. A truncated ver
• OMIM: 179410

Protein Summary

• Protein general information: P35241  
  • Name: Radixin
  • Length: 583  
  • Mass: 68564
• Sequence:

  MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENP
  LQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLAND
  RLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGL
  NIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
  EVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLKQIEEQTIKAQKELEEQTRKALEL
  DQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAF
  AAQEDLEKTKEELKTVMSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTETQKNERVK
  KQLQALSSELAQARDETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAM

• Structural information:
  • Protein Domains: (5..29-)
    (/note="FERM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00084"-)
  • Interpro: IPR019749  IPR011174  IPR011259  IPR041789  IPR000798   IPR014352  IPR035963  IPR019748  IPR019747  IPR000299  IPR018979  IPR018980  IPR008954  IPR011993  IPR029071  
  • Prosite: PS00660 PS00661 PS50057
  • CDD: cd14473 cd13194
  • STRING: ENSP00000384136
• Other Databases: GeneCards:  RDX  Malacards:  RDX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005902	microvillus	ISS	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0008092	cytoskeletal protein binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0051693	actin filament capping	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051016	barbed-end actin filament capping	IEA	biological process
GO:0045176	apical protein localization	IEA	biological process
GO:0036120	cellular response to platelet-derived growth factor stimulus	IEA	biological process
GO:0030315	T-tubule	IEA	cellular component
GO:0005902	microvillus	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:1900087	positive regulation of G1/S transition of mitotic cell cycle	IEA	biological process
GO:0097067	cellular response to thyroid hormone stimulus	IEA	biological process
GO:0045177	apical part of cell	IEA	cellular component
GO:0045176	apical protein localization	IEA	biological process
GO:0030175	filopodium	IEA	cellular component
GO:0005902	microvillus	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0051286	cell tip	IEA	cellular component
GO:0032154	cleavage furrow	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045184	establishment of protein localization	IEA	biological process
GO:0032420	stereocilium	IEA	cellular component
GO:0030864	cortical actin cytoskeleton	IEA	cellular component
GO:0030033	microvillus assembly	IEA	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0005925	focal adhesion	IDA	colocalizes with
GO:0005902	microvillus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0032154	cleavage furrow	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0003779	actin binding	IDA	molecular function
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0071944	cell periphery	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0061028	establishment of endothelial barrier	IGI	biological process
GO:0010628	positive regulation of gene expression	IGI	biological process
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:0034111	negative regulation of homotypic cell-cell adhesion	IMP	biological process
GO:0032231	regulation of actin filament bundle assembly	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0051018	protein kinase A binding	ISS	molecular function
GO:1900087	positive regulation of G1/S transition of mitotic cell cycle	ISS	biological process
GO:0005925	focal adhesion	HDA	cellular component
GO:1903392	negative regulation of adherens junction organization	IMP	biological process
GO:0005886	plasma membrane	ISS	colocalizes with
GO:0051117	ATPase binding	IPI	molecular function
GO:0043087	regulation of GTPase activity	IGI	biological process
GO:0030864	cortical actin cytoskeleton	ISS	cellular component
GO:0030027	lamellipodium	ISS	cellular component
GO:0045184	establishment of protein localization	ISS	biological process
GO:0032487	regulation of Rap protein signal transduction	ISS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0008360	regulation of cell shape	IMP	biological process
GO:1900027	regulation of ruffle assembly	IMP	biological process
GO:0045792	negative regulation of cell size	IMP	biological process
GO:0030175	filopodium	ISS	cellular component
GO:0005902	microvillus	ISS	cellular component
GO:0097067	cellular response to thyroid hormone stimulus	ISS	biological process
GO:0010737	protein kinase A signaling	ISS	biological process
GO:0008361	regulation of cell size	IGI	biological process
GO:0008361	regulation of cell size	IGI	biological process
GO:0034260	negative regulation of GTPase activity	IMP	biological process
GO:1903364	positive regulation of cellular protein catabolic process	IGI	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902115	regulation of organelle assembly	IGI	biological process
GO:1902966	positive regulation of protein localization to early endosome	IGI	biological process
GO:2000643	positive regulation of early endosome to late endosome transport	IGI	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer
hsa04810	Regulation of actin cytoskeleton
hsa05205	Proteoglycans in cancer
hsa04530	Tight junction

Diseases

Associated diseases	References
Deafness, autosomal recessive	KEGG:H00605
Deafness, autosomal recessive	KEGG:H00605
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R