• Gene id: 5949

Gene Summary

• Gene Symbol: RBP3   Gene   UCSC   Ensembl
• Aliases: D10S64, D10S65, D10S66, IRBP, RBPI, RP66
• Gene name: retinol binding protein 3
• Alternate names: retinol-binding protein 3, interphotoreceptor retinoid-binding protein, interstitial retinol binding protein 3, retinol binding protein 3, interstitial,
• Gene location: 10q11.22 (47348362: 47357880)     Exons: 4     NC_000010.11
• Gene summary(Entrez): Interphotoreceptor retinol-binding protein is a large glycoprotein known to bind retinoids and found primarily in the interphotoreceptor matrix of the retina between the retinal pigment epithelium and the photoreceptor cells. It is thought to transport re

Protein Summary

• Protein general information: P10745  
  • Name: Retinol binding protein 3 (Interphotoreceptor retinoid binding protein) (IRBP) (Interstitial retinol binding protein)
  • Length: 1247  
  • Mass: 135363
• Sequence:

  MMREWVLLMSVLLCGLAGPTHLFQPSLVLDMAKVLLDNYCFPENLLGMQEAIQQAIKSHEILSISDPQTLASVLT
  AGVQSSLNDPRLVISYEPSTPEPPPQVPALTSLSEEELLAWLQRGLRHEVLEGNVGYLRVDSVPGQEVLSMMGEF
  LVAHVWGNLMGTSALVLDLRHCTGGQVSGIPYIISYLHPGNTILHVDTIYNRPSNTTTEIWTLPQVLGERYGADK
  DVVVLTSSQTRGVAEDIAHILKQMRRAIVVGERTGGGALDLRKLRIGESDFFFTVPVSRSLGPLGGGSQTWEGSG
  VLPCVGTPAEQALEKALAILTLRSALPGVVHCLQEVLKDYYTLVDRVPTLLQHLASMDFSTVVSEEDLVTKLNAG
  LQAASEDPRLLVRAIGPTETPSWPAPDAAAEDSPGVAPELPEDEAIRQALVDSVFQVSVLPGNVGYLRFDSFADA
  SVLGVLAPYVLRQVWEPLQDTEHLIMDLRHNPGGPSSAVPLLLSYFQGPEAGPVHLFTTYDRRTNITQEHFSHME
  LPGPRYSTQRGVYLLTSHRTATAAEEFAFLMQSLGWATLVGEITAGNLLHTRTVPLLDTPEGSLALTVPVLTFID
  NHGEAWLGGGVVPDAIVLAEEALDKAQEVLEFHQSLGALVEGTGHLLEAHYARPEVVGQTSALLRAKLAQGAYRT
  AVDLESLASQLTADLQEVSGDHRLLVFHSPGELVVEEAPPPPPAVPSPEELTYLIEALFKTEVLPGQLGYLRFDA
  MAELETVKAVGPQLVRLVWQQLVDTAALVIDLRYNPGSYSTAIPLLCSYFFEAEPRQHLYSVFDRATSKVTEVWT
  LPQVAGQRYGSHKDLYILMSHTSGSAAEAFAHTMQDLQRATVIGEPTAGGALSVGIYQVGSSPLYASMPTQMAMS
  ATTGKAWDLAGVEPDITVPMSEALSIAQDIVALRAKVPTVLQTAGKLVADNYASAELGAKMATKLSGLQSRYSRV
  TSEVALAEILGADLQMLSGDPHLKAAHIPENAKDRIPGIVPMQIPSPEVFEELIKFSFHTNVLEDNIGYLRFDMF
  GDGELLTQVSRLLVEHIWKKIMHTDAMIIDMRFNIGGPTSSIPILCSYFFDEGPPVLLDKIYSRPDDSVSELWTH
  AQVVGERYGSKKSMVILTSSVTAGTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSVGA
  SDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDHL

• Structural information:
  • Interpro: IPR029045  IPR032956  IPR005151  
  • STRING: ENSP00000463151
• Other Databases: GeneCards:  RBP3  Malacards:  RBP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090658	cone matrix sheath	IBA	cellular component
GO:0019841	retinol binding	IBA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005501	retinoid binding	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0007601	visual perception	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0016918	retinal binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005501	retinoid binding	TAS	molecular function
GO:0006629	lipid metabolic process	TAS	biological process
GO:0007601	visual perception	TAS	biological process
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0005501	retinoid binding	TAS	molecular function
GO:0005501	retinoid binding	TAS	molecular function
GO:0005501	retinoid binding	TAS	molecular function
GO:0005501	retinoid binding	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019841	retinol binding	IEA	molecular function
GO:0033165	interphotoreceptor matrix	IEA	cellular component
GO:0033165	interphotoreceptor matrix	IEA	cellular component
GO:1903561	extracellular vesicle	HDA	cellular component

Diseases

Associated diseases	References
Retinitis pigmentosa	KEGG:H00527
Retinitis pigmentosa	KEGG:H00527
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray