• Gene id: 594855

Gene Summary

• Gene Symbol: CPLX3   Gene   UCSC   Ensembl
• Aliases: CPX-III, CPXIII, Nbla11589
• Gene name: complexin 3
• Alternate names: complexin-3, CPX III, complexin III, epididymis secretory sperm binding protein,
• Gene location: 15q24.1 (74826626: 74831801)     Exons: 3     NC_000015.10

Protein Summary

• Protein general information: Q8WVH0  
  • Name: Complexin 3 (Complexin III) (CPX III)
  • Length: 158  
  • Mass: 17557
• Sequence:

  MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDAQFTQRKAERATLRSH
  FRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKASVLGQLASLPGLNLGSLKDKAQATLGDLKQ
  SAEKCHVM

• Structural information:
  • Interpro: IPR008849  
  • STRING: ENSP00000378464
• Other Databases: GeneCards:  CPLX3  Malacards:  CPLX3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000149	SNARE binding	IBA	molecular function
GO:0016079	synaptic vesicle exocytosis	IBA	biological process
GO:0031201	SNARE complex	IBA	cellular component
GO:0043195	terminal bouton	IBA	cellular component
GO:0046928	regulation of neurotransmitter secretion	IBA	biological process
GO:0006836	neurotransmitter transport	IEA	biological process
GO:0019905	syntaxin binding	IEA	molecular function
GO:0007601	visual perception	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0006836	neurotransmitter transport	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0098993	anchored component of synaptic vesicle membrane	IEA	cellular component
GO:0046928	regulation of neurotransmitter secretion	IEA	biological process
GO:0031630	regulation of synaptic vesicle fusion to presynaptic active zone membrane	IEA	biological process
GO:0030073	insulin secretion	IEA	biological process
GO:0016079	synaptic vesicle exocytosis	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005326	neurotransmitter transmembrane transporter activity	IEA	molecular function
GO:0099029	anchored component of presynaptic active zone membrane	IEA	cellular component
GO:0098684	photoreceptor ribbon synapse	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0000149	SNARE binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04721	Synaptic vesicle cycle

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq