• Gene id: 5948

Gene Summary

• Gene Symbol: RBP2   Gene   UCSC   Ensembl
• Aliases: CRABP-II, CRBP2, CRBPII, RBPC2
• Gene name: retinol binding protein 2
• Alternate names: retinol-binding protein 2, CRBP-II, cellular retinol-binding protein II, retinol binding protein 2, cellular,
• Gene location: 3q23 (139476515: 139452883)     Exons: 4     NC_000003.12
• Gene summary(Entrez): This gene encodes an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiati
• OMIM: 180280

Protein Summary

• Protein general information: P50120  
  • Name: Retinol binding protein 2 (Cellular retinol binding protein II) (CRBP II)
  • Length: 134  
  • Mass: 15707
  • Tissue specificity: Higher expression in adult small intestine and to a much lesser extent in fetal kidney. {ECO
• Sequence:

  MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYT
  KSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK

• Structural information:
  • Interpro: IPR012674  IPR000463  IPR031259  IPR000566  
  • Prosite: PS00214
  • PDB: 2RCQ 2RCT 4EDE 4EEJ 4EFG 4EXZ 4GKC 4QYN 4QYP 4QZT 4QZU 4RUU 4ZCB 4ZGU 4ZH6 4ZH9 4ZJ0 4ZR2 5DG4 5DPQ 5F58 5F6B 5F7G 5FAZ 5FEN 5FFH 5U6G 6BTH 6BTI 6C7Z 6E50 6E51 6E5E 6E5Q 6E5R 6E5S 6E6L 6E7M 6MCU 6MCV 6MKV 6MLB 6ON5 6ON7 6ON8
  • PDBsum: 2RCQ 2RCT 4EDE 4EEJ 4EFG 4EXZ 4GKC 4QYN 4QYP 4QZT 4QZU 4RUU 4ZCB 4ZGU 4ZH6 4ZH9 4ZJ0 4ZR2 5DG4 5DPQ 5F58 5F6B 5F7G 5FAZ 5FEN 5FFH 5U6G 6BTH 6BTI 6C7Z 6E50 6E51 6E5E 6E5Q 6E5R 6E5S 6E6L 6E7M 6MCU 6MCV 6MKV 6MLB 6ON5 6ON7 6ON8
  • STRING: ENSP00000232217
• Other Databases: GeneCards:  RBP2  Malacards:  RBP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008289	lipid binding	IEA	molecular function
GO:0016918	retinal binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0019841	retinol binding	IEA	molecular function
GO:0005501	retinoid binding	TAS	molecular function
GO:0006776	vitamin A metabolic process	TAS	biological process
GO:0008544	epidermis development	TAS	biological process
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0019841	retinol binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04977	Vitamin digestion and absorption

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)