• Gene id: 5947

Gene Summary

• Gene Symbol: RBP1   Gene   UCSC   Ensembl
• Aliases: CRABP-I, CRBP, CRBP1, CRBPI, RBPC
• Gene name: retinol binding protein 1
• Alternate names: retinol-binding protein 1, CRBP-I, cellular retinol binding protein 1, cellular retinol-binding protein I, retinol-binding protein 1, cellular,
• Gene location: 3q23 (139539741: 139517437)     Exons: 6     NC_000003.12
• Gene summary(Entrez): This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues,
• OMIM: 180260

Protein Summary

• Protein general information: P09455  
  • Name: Retinol binding protein 1 (Cellular retinol binding protein) (CRBP) (Cellular retinol binding protein I) (CRBP I)
  • Length: 135  
  • Mass: 15850
  • Tissue specificity: Detected in nearly all the tissues with higher expression in adult ovary, pancreas, pituitary gland and adrenal gland, and fetal liver. {ECO
• Sequence:

  MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDL
  TGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ

• Structural information:
  • Interpro: IPR012674  IPR031264  IPR000463  IPR031259  IPR000566  
  • Prosite: PS00214
  • PDB: 5H8T 5H9A 5HA1 5HBS 5LJB 5LJC 5LJD 5LJE 5LJG 5LJH 5LJK 6E5L 6E5T 6E6M
  • PDBsum: 5H8T 5H9A 5HA1 5HBS 5LJB 5LJC 5LJD 5LJE 5LJG 5LJH 5LJK 6E5L 6E5T 6E6M
  • STRING: ENSP00000232219
• Other Databases: GeneCards:  RBP1  Malacards:  RBP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005811	lipid droplet	IDA	cellular component
GO:1904768	all-trans-retinol binding	IDA	molecular function
GO:0006776	vitamin A metabolic process	IMP	biological process
GO:0055088	lipid homeostasis	IMP	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0002138	retinoic acid biosynthetic process	IEA	biological process
GO:0006776	vitamin A metabolic process	IEA	biological process
GO:0016918	retinal binding	IEA	molecular function
GO:0005811	lipid droplet	IEA	cellular component
GO:0019841	retinol binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005501	retinoid binding	TAS	molecular function
GO:0006776	vitamin A metabolic process	TAS	biological process
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005811	lipid droplet	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic failure	MIK: 17921478
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
17921478	Spermatogenic failure			69 samples	Male infertility	Microarray