• Gene id: 5939

Gene Summary

• Gene Symbol: RBMS2   Gene   UCSC   Ensembl
• Aliases: SCR3
• Gene name: RNA binding motif single stranded interacting protein 2
• Alternate names: RNA-binding motif, single-stranded-interacting protein 2, suppressor of CDC2 with RNA-binding motif 3,
• Gene location: 12q13.3 (56520405: 56596192)     Exons: 23     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP
• OMIM: 602387

Protein Summary

• Protein general information: Q15434  
  • Name: RNA binding motif, single stranded interacting protein 2 (Suppressor of CDC2 with RNA binding motif 3)
  • Length: 407  
  • Mass: 43959
• Sequence:

  MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGNDQLSKTNLYIRGLQPGTTDQDLVKL
  CQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPSAAQKAVTALKASGVQAQMAKQQEQDPTNLYISNLPLSMDEQE
  LEGMLKPFGQVISTRILRDTSGTSRGVGFARMESTEKCEAIITHFNGKYIKTPPGVPAPSDPLLCKFADGGPKKR
  QNQGKFVQNGRAWPRNADMGVMALTYDPTTALQNGFYPAPYNITPNRMLAQSALSPYLSSPVSSYQRVTQTSPLQ
  VPNPSWMHHHSYLMQPSGSVLTPGMDHPISLQPASMMGPLTQQLGHLSLSSTGTYMPTAAAMQGAYISQYTPVPS
  SSVSVEESSGQQNQVAVDAPSEHGVYSFQFNK

• Structural information:
  • Protein Domains: (56..12-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (135..22-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR000504  
  • Prosite: PS50102
  • PDB: 1X4E
  • PDBsum: 1X4E
  • STRING: ENSP00000262031
• Other Databases: GeneCards:  RBMS2  Malacards:  RBMS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003723	RNA binding	IBA	molecular function
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	TAS	molecular function
GO:0006396	RNA processing	TAS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881