• Gene id: 5936

Gene Summary

• Gene Symbol: RBM4   Gene   UCSC   Ensembl
• Aliases: LARK, RBM4A, ZCCHC21, ZCRB3A
• Gene name: RNA binding motif protein 4
• Alternate names: RNA-binding protein 4, RNA-binding motif protein 4a, lark homolog, transcriptional coactivator CoAZ, zinc finger CCHC-type and RNA binding motif 3A,
• Gene location: 11q13.2 (66638616: 66668379)     Exons: 5     NC_000011.10
• OMIM: 0

Protein Summary

• Protein general information: Q9BWF3  
  • Name: RNA binding protein 4 (Lark homolog) (hLark) (RNA binding motif protein 4) (RNA binding motif protein 4a)
  • Length: 364  
  • Mass: 40314
  • Tissue specificity: Expressed in the cerebellum. Expressed in neurons and glial cells, including layers II neurons in the frontal cortex and CA1 pyramidal neurons in the hippocampus. Expressed in heart, liver, pancreas, skeletal muscle, placenta, primary
• Sequence:

  MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSK
  TSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQLSTSRL
  RTAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPYTMSYGDSLYYNNAYGALDAYYKRC
  RAARSYEAVAAAAASVYNYAEQTLSQLPQVQNTAMASHLTSTSLDPYDRHLLPTSGAAATAAAAAAAAAAVTAAS
  TSYYGRDRSPLRRATAPVPTVGEGYGYGHESELSQASAAARNSLYDMARYEREQYADRARYSAF

• Structural information:
  • Protein Domains: (2..7-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (78..14-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR034897  IPR034898  IPR000504   IPR001878  
  • Prosite: PS50102 PS50158
  • CDD: cd12606 cd12607
  • PDB: 2DNQ
  • PDBsum: 2DNQ
  • DIP: 44199
  • STRING: ENSP00000386894
• Other Databases: GeneCards:  RBM4  Malacards:  RBM4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003729	mRNA binding	IBA	molecular function
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0016607	nuclear speck	IBA	cellular component
GO:0045292	mRNA cis splicing, via spliceosome	IBA	biological process
GO:0097158	pre-mRNA intronic pyrimidine-rich binding	IDA	molecular function
GO:0097158	pre-mRNA intronic pyrimidine-rich binding	IDA	molecular function
GO:0097157	pre-mRNA intronic binding	IDA	molecular function
GO:0051149	positive regulation of muscle cell differentiation	IDA	biological process
GO:0046822	regulation of nucleocytoplasmic transport	IDA	biological process
GO:0046822	regulation of nucleocytoplasmic transport	IDA	biological process
GO:0045947	negative regulation of translational initiation	IDA	biological process
GO:0035198	miRNA binding	IDA	molecular function
GO:0017148	negative regulation of translation	IDA	biological process
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003729	mRNA binding	IDA	molecular function
GO:0002190	cap-independent translational initiation	IDA	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0035278	miRNA mediated inhibition of translation	IDA	biological process
GO:0032055	negative regulation of translation in response to stress	IDA	biological process
GO:0016607	nuclear speck	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0002192	IRES-dependent translational initiation of linear mRNA	IDA	biological process
GO:0097167	circadian regulation of translation	ISS	biological process
GO:0043153	entrainment of circadian clock by photoperiod	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003730	mRNA 3'-UTR binding	ISS	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0003723	RNA binding	TAS	molecular function
GO:0006396	RNA processing	TAS	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0046685	response to arsenic-containing substance	IDA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0030332	cyclin binding	IPI	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R