• Gene id: 59352

Gene Summary

• Gene Symbol: LGR6   Gene   UCSC   Ensembl
• Aliases: GPCR, VTS20631
• Gene name: leucine rich repeat containing G protein-coupled receptor 6
• Alternate names: leucine-rich repeat-containing G-protein coupled receptor 6, gonadotropin receptor,
• Gene location: 1q32.1 (202193989: 202319760)     Exons: 27     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the leucine-rich repeat-containing subgroup of the G protein-coupled 7-transmembrane protein superfamily. The encoded protein is a glycoprotein hormone receptor with a large N-terminal extracellular domain that contains leuci
• OMIM: 180710

Protein Summary

• Protein general information: Q9HBX8  
  • Name: Leucine rich repeat containing G protein coupled receptor 6
  • Length: 967  
  • Mass: 104298
• Sequence:

  MPSPPGLRALWLCAALCASRRAGGAPQPGPGPTACPAPCHCQEDGIMLSADCSELGLSAVPGDLDPLTAYLDLSM
  NNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLYSLKILMLQNNQLGGIPAEALWELPSLQSLRLDANLI
  SLVPERSFEGLSSLRHLWLDDNALTEIPVRALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHL
  GTHSFEGLHNLETLDLNYNKLQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQFVGRSA
  FQYLPKLHTLSLNGAMDIQEFPDLKGTTSLEILTLTRAGIRLLPSGMCQQLPRLRVLELSHNQIEELPSLHRCQK
  LEEIGLQHNRIWEIGADTFSQLSSLQALDLSWNAIRSIHPEAFSTLHSLVKLDLTDNQLTTLPLAGLGGLMHLKL
  KGNLALSQAFSKDSFPKLRILEVPYAYQCCPYGMCASFFKASGQWEAEDLHLDDEESSKRPLGLLARQAENHYDQ
  DLDELQLEMEDSKPHPSVQCSPTPGPFKPCEYLFESWGIRLAVWAIVLLSVLCNGLVLLTVFAGGPVPLPPVKFV
  VGAIAGANTLTGISCGLLASVDALTFGQFSEYGARWETGLGCRATGFLAVLGSEASVLLLTLAAVQCSVSVSCVR
  AYGKSPSLGSVRAGVLGCLALAGLAAALPLASVGEYGASPLCLPYAPPEGQPAALGFTVALVMMNSFCFLVVAGA
  YIKLYCDLPRGDFEAVWDCAMVRHVAWLIFADGLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPL
  LYLLFNPHFRDDLRRLRPRAGDSGPLAYAAAGELEKSSCDSTQALVAFSDVDLILEASEAGRPPGLETYGFPSVT
  LISCQQPGAPRLEGSHCVEPEGNHFGNPQPSMDGELLLRAEGSTPAGGGLSGGGGFQPSGLAFASHV

• Structural information:
  • Protein Domains: (26..6-)
    (/note="LRRNT"-)
  • Interpro: IPR000276  IPR002131  IPR001611  IPR003591  IPR032675   IPR000372  
  • Prosite: PS51450
  • STRING: ENSP00000356247
• Other Databases: GeneCards:  LGR6  Malacards:  LGR6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007411	axon guidance	IBA	biological process
GO:0008201	heparin binding	IBA	molecular function
GO:0048495	Roundabout binding	IBA	molecular function
GO:0050919	negative chemotaxis	IBA	biological process
GO:0032588	trans-Golgi network membrane	ISS	cellular component
GO:0090263	positive regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004930	G protein-coupled receptor activity	ISS	NOT|molecular function
GO:0004888	transmembrane signaling receptor activity	ISS	molecular function
GO:0016500	protein-hormone receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:1990523	bone regeneration	IEA	biological process
GO:0042246	tissue regeneration	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0030177	positive regulation of Wnt signaling pathway	IDA	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq