• Gene id: 59351

Gene Summary

• Gene Symbol: PBOV1   Gene   UCSC   Ensembl
• Aliases: UC28, UROC28, dJ171N11.2
• Gene name: prostate and breast cancer overexpressed 1
• Alternate names: prostate and breast cancer overexpressed gene 1 protein,
• Gene location: 6q23.3 (177022639: 176905004)     Exons: 22     NC_000005.10
• Gene summary(Entrez): This intronless gene encodes a protein of unknown function. Its expression is up-regulated in some types of cancer, including prostate, breast, and bladder cancer. [provided by RefSeq, Aug 2011]
• OMIM: 605669

Protein Summary

• Protein general information: Q9GZY1  
  • Name: Prostate and breast cancer overexpressed gene 1 protein (Protein UROC28) (UC28)
  • Length: 135  
  • Mass: 15722
  • Tissue specificity: Expressed in colon, prostate, small intestine, testis and spleen, with lower expression in thymus, ovary, and peripheral blood leukocytes. Up-regulated expression in prostate, breast, and bladder cancer, but not in lung and colon cance
• Sequence:

  MRAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFIDYSIEQ
  SHHAILTPLQTHLTMKGSSMKCSSLSSEAILFTLTLQLTQTLGLECCLLYLSKTIHPQII

• Other Databases: GeneCards:  PBOV1  Malacards:  PBOV1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)