• Gene id: 59344

Gene Summary

• Gene Symbol: ALOXE3   Gene   UCSC   Ensembl
• Aliases: ARCI3, E-LOX, eLOX-3, eLOX3
• Gene name: arachidonate lipoxygenase 3
• Alternate names: hydroperoxide isomerase ALOXE3, Epidermal lipoxygenase-3, e-LOX-3, epidermal LOX-3, epidermal lipoxygenase, epidermis-type lipoxygenase 3, hydroperoxy icosatetraenoate dehydratase,
• Gene location: 17p13.1 (8118915: 8095899)     Exons: 19     NC_000017.11
• Gene summary(Entrez): This gene is a member of the lipoxygenase family, which are catabolized by arachidonic acid-derived compounds. The encoded enzyme is a hydroperoxide isomerase that synthesizes a unique type of epoxy alcohol (8R-hydroxy-11R,12R-epoxyeicosa-5Z,9E,14Z-trieno

Protein Summary

• Protein general information: Q9BYJ1  
  • Name: Hydroperoxide isomerase ALOXE3 (EC 5.4.4.7) (Epidermis type lipoxygenase 3) (Epidermal LOX 3) (e LOX 3) (eLOX 3) (Hydroperoxy icosatetraenoate dehydratase) (EC 4.2.1.152)
  • Length: 711  
  • Mass: 80543
  • Tissue specificity: Predominantly expressed in skin.
• Sequence:

  MAVYRLCVTTGPYLRAGTLDNISVTLVGTCGESPKQRLDRMGRDFAPGSVQKYKVRCTAELGELLLLRVHKERYA
  FFRKDSWYCSRICVTEPDGSVSHFPCYQWIEGYCTVELRPGTARTICQDSLPLLLDHRTRELRARQECYRWKIYA
  PGFPCMVDVNSFQEMESDKKFALTKTTTCVDQGDSSGNRYLPGFPMKIDIPSLMYMEPNVRYSATKTISLLFNAI
  PASLGMKLRGLLDRKGSWKKLDDMQNIFWCHKTFTTKYVTEHWCEDHFFGYQYLNGVNPVMLHCISSLPSKLPVT
  NDMVAPLLGQDTCLQTELERGNIFLADYWILAEAPTHCLNGRQQYVAAPLCLLWLSPQGALVPLAIQLSQTPGPD
  SPIFLPTDSEWDWLLAKTWVRNSEFLVHENNTHFLCTHLLCEAFAMATLRQLPLCHPIYKLLLPHTRYTLQVNTI
  ARATLLNPEGLVDQVTSIGRQGLIYLMSTGLAHFTYTNFCLPDSLRARGVLAIPNYHYRDDGLKIWAAIESFVSE
  IVGYYYPSDASVQQDSELQAWTGEIFAQAFLGRESSGFPSRLCTPGEMVKFLTAIIFNCSAQHAAVNSGQHDFGA
  WMPNAPSSMRQPPPQTKGTTTLKTYLDTLPEVNISCNNLLLFWLVSQEPKDQRPLGTYPDEHFTEEAPRRSIAAF
  QSRLAQISRDIQERNQGLALPYTYLDPPLIENSVSI

• Structural information:
  • Protein Domains: (2..11-)
    (/note="PLAT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00152-)
    (120..71-)
    (/note="Lipoxygenase-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00726"-)
  • Interpro: IPR000907  IPR013819  IPR036226  IPR020834  IPR020833   IPR001885  IPR001024  IPR036392  IPR042062  
  • Prosite: PS00711 PS00081 PS51393 PS50095
  • CDD: cd01753
  • STRING: ENSP00000314879
• Other Databases: GeneCards:  ALOXE3  Malacards:  ALOXE3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019372	lipoxygenase pathway	IBA	biological process
GO:0043651	linoleic acid metabolic process	IBA	biological process
GO:0019369	arachidonic acid metabolic process	IBA	biological process
GO:0051120	hepoxilin A3 synthase activity	IBA	molecular function
GO:0051122	hepoxilin biosynthetic process	IBA	biological process
GO:0016702	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IDA	molecular function
GO:0050486	intramolecular transferase activity, transferring hydroxy groups	IDA	molecular function
GO:0050486	intramolecular transferase activity, transferring hydroxy groups	IDA	molecular function
GO:0043651	linoleic acid metabolic process	IDA	biological process
GO:0043651	linoleic acid metabolic process	IDA	biological process
GO:0019372	lipoxygenase pathway	IDA	biological process
GO:0016702	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IDA	molecular function
GO:0016702	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IDA	NOT|molecular function
GO:0006665	sphingolipid metabolic process	IDA	biological process
GO:0051122	hepoxilin biosynthetic process	IDA	biological process
GO:0051122	hepoxilin biosynthetic process	IDA	biological process
GO:0051120	hepoxilin A3 synthase activity	IDA	molecular function
GO:0051120	hepoxilin A3 synthase activity	IDA	molecular function
GO:0019369	arachidonic acid metabolic process	IDA	biological process
GO:0019369	arachidonic acid metabolic process	IDA	biological process
GO:0046513	ceramide biosynthetic process	ISS	biological process
GO:0045444	fat cell differentiation	ISS	biological process
GO:0035357	peroxisome proliferator activated receptor signaling pathway	ISS	biological process
GO:0061436	establishment of skin barrier	ISS	biological process
GO:0019233	sensory perception of pain	ISS	biological process
GO:0005506	iron ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016829	lyase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0051213	dioxygenase activity	IEA	molecular function
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0016853	isomerase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0106255	hydroperoxy icosatetraenoate isomerase activity	IEA	molecular function
GO:0106256	hydroperoxy icosatetraenoate dehydratase activity	IEA	molecular function
GO:0051120	hepoxilin A3 synthase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0019372	lipoxygenase pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046513	ceramide biosynthetic process	IEA	biological process
GO:0045444	fat cell differentiation	IEA	biological process
GO:0043651	linoleic acid metabolic process	IEA	biological process
GO:0035357	peroxisome proliferator activated receptor signaling pathway	IEA	biological process
GO:0061436	establishment of skin barrier	IEA	biological process
GO:0051122	hepoxilin biosynthetic process	IEA	biological process
GO:0051120	hepoxilin A3 synthase activity	IEA	molecular function
GO:0019369	arachidonic acid metabolic process	IEA	biological process
GO:0051122	hepoxilin biosynthetic process	IEA	biological process
GO:0019369	arachidonic acid metabolic process	IEA	biological process
GO:0019233	sensory perception of pain	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006665	sphingolipid metabolic process	IEA	biological process
GO:0019372	lipoxygenase pathway	IBA	biological process
GO:0043651	linoleic acid metabolic process	IBA	biological process
GO:0019369	arachidonic acid metabolic process	IBA	biological process
GO:0051120	hepoxilin A3 synthase activity	IBA	molecular function
GO:0051122	hepoxilin biosynthetic process	IBA	biological process
GO:0016702	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IDA	molecular function
GO:0050486	intramolecular transferase activity, transferring hydroxy groups	IDA	molecular function
GO:0050486	intramolecular transferase activity, transferring hydroxy groups	IDA	molecular function
GO:0043651	linoleic acid metabolic process	IDA	biological process
GO:0043651	linoleic acid metabolic process	IDA	biological process
GO:0019372	lipoxygenase pathway	IDA	biological process
GO:0016702	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IDA	molecular function
GO:0016702	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IDA	NOT|molecular function
GO:0006665	sphingolipid metabolic process	IDA	biological process
GO:0051122	hepoxilin biosynthetic process	IDA	biological process
GO:0051122	hepoxilin biosynthetic process	IDA	biological process
GO:0051120	hepoxilin A3 synthase activity	IDA	molecular function
GO:0051120	hepoxilin A3 synthase activity	IDA	molecular function
GO:0019369	arachidonic acid metabolic process	IDA	biological process
GO:0019369	arachidonic acid metabolic process	IDA	biological process
GO:0046513	ceramide biosynthetic process	ISS	biological process
GO:0045444	fat cell differentiation	ISS	biological process
GO:0035357	peroxisome proliferator activated receptor signaling pathway	ISS	biological process
GO:0061436	establishment of skin barrier	ISS	biological process
GO:0019233	sensory perception of pain	ISS	biological process
GO:0005506	iron ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016829	lyase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0051213	dioxygenase activity	IEA	molecular function
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0016853	isomerase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0106255	hydroperoxy icosatetraenoate isomerase activity	IEA	molecular function
GO:0106256	hydroperoxy icosatetraenoate dehydratase activity	IEA	molecular function
GO:0051120	hepoxilin A3 synthase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0019372	lipoxygenase pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046513	ceramide biosynthetic process	IEA	biological process
GO:0045444	fat cell differentiation	IEA	biological process
GO:0043651	linoleic acid metabolic process	IEA	biological process
GO:0035357	peroxisome proliferator activated receptor signaling pathway	IEA	biological process
GO:0061436	establishment of skin barrier	IEA	biological process
GO:0051122	hepoxilin biosynthetic process	IEA	biological process
GO:0051120	hepoxilin A3 synthase activity	IEA	molecular function
GO:0019369	arachidonic acid metabolic process	IEA	biological process
GO:0051122	hepoxilin biosynthetic process	IEA	biological process
GO:0019369	arachidonic acid metabolic process	IEA	biological process
GO:0019233	sensory perception of pain	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006665	sphingolipid metabolic process	IEA	biological process

Diseases

Associated diseases	References
Autosomal recessive congenital ichthyosis	KEGG:H00734
Autosomal recessive congenital ichthyosis	KEGG:H00734
Autosomal recessive congenital ichthyosis 1	PMID:11773004
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray