• Gene id: 59343

Gene Summary

• Gene Symbol: SENP2   Gene   UCSC   Ensembl
• Aliases: AXAM2, SMT3IP2
• Gene name: SUMO specific peptidase 2
• Alternate names: sentrin-specific protease 2, SMT3-specific isopeptidase 2, SUMO1/sentrin/SMT3 specific peptidase 2, SUMO1/sentrin/SMT3 specific protease 2, sentrin (SUMO1) specific peptidase 2, sentrin/SUMO-specific protease SENP2,
• Gene location: 3q27.2 (185586294: 185633550)     Exons: 17     NC_000003.12
• Gene summary(Entrez): SUMO1 (UBL1; MIM 601912) is a small ubiquitin-like protein that can be covalently conjugated to other proteins. SENP2 is one of a group of enzymes that process newly synthesized SUMO1 into the conjugatable form and catalyze the deconjugation of SUMO1-cont
• OMIM: 608261

Protein Summary

• Protein general information: Q9HC62  
  • Name: Sentrin specific protease 2 (EC 3.4.22. ) (Axam2) (SMT3 specific isopeptidase 2) (Smt3ip2) (Sentrin/SUMO specific protease SENP2)
  • Length: 589  
  • Mass: 67855
• Sequence:

  MYRWLVRILGTIFRFCDRSVPPARALLKRRRSDSTLFSTVDTDEIPAKRPRLDCFIHQVKNSLYNAASLFGFPFQ
  LTTKPMVTSACNGTRNVAPSGEVFSNSSSCELTGSGSWNNMLKLGNKSPNGISDYPKIRVTVTRDQPRRVLPSFG
  FTLNSEGCNRRPGGRRHSKGNPESSLMWKPQEQAVTEMISEESGKGLRRPHCTVEEGVQKEEREKYRKLLERLKE
  SGHGNSVCPVTSNYHSSQRSQMDTLKTKGWGEEQNHGVKTTQFVPKQYRLVETRGPLCSLRSEKRCSKGKITDTE
  TMVGIRFENESRRGYQLEPDLSEEVSARLRLGSGSNGLLRRKVSIIETKEKNCSGKERDRRTDDLLELTEDMEKE
  ISNALGHGPQDEILSSAFKLRITRGDIQTLKNYHWLNDEVINFYMNLLVERNKKQGYPALHVFSTFFYPKLKSGG
  YQAVKRWTKGVNLFEQEIILVPIHRKVHWSLVVIDLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRNSDLN
  LLEWTHHSMKPHEIPQQLNGSDCGMFTCKYADYISRDKPITFTQHQMPLFRKKMVWEILHQQLL

• Structural information:
  • Interpro: IPR038765  IPR003653  
  • Prosite: PS50600
  • PDB: 1TGZ 1TH0 2IO0 2IO1 2IO2 2IO3 3ZO5 5AEK
  • PDBsum: 1TGZ 1TH0 2IO0 2IO1 2IO2 2IO3 3ZO5 5AEK
  • DIP: 29254
  • STRING: ENSP00000296257
• Other Databases: GeneCards:  SENP2  Malacards:  SENP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016926	protein desumoylation	IMP	biological process
GO:0031648	protein destabilization	IMP	biological process
GO:0031398	positive regulation of protein ubiquitination	IMP	biological process
GO:0031397	negative regulation of protein ubiquitination	IDA	biological process
GO:0016926	protein desumoylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0016926	protein desumoylation	IDA	biological process
GO:0045444	fat cell differentiation	ISS	biological process
GO:0016926	protein desumoylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016605	PML body	ISS	colocalizes with
GO:0006508	proteolysis	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0051028	mRNA transport	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0005643	nuclear pore	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016925	protein sumoylation	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016926	protein desumoylation	IEA	biological process
GO:0045444	fat cell differentiation	IEA	biological process
GO:2000045	regulation of G1/S transition of mitotic cell cycle	IEA	biological process
GO:0009950	dorsal/ventral axis specification	IEA	biological process
GO:0032091	negative regulation of protein binding	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0016604	nuclear body	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0032875	regulation of DNA endoreduplication	IEA	biological process
GO:0035562	negative regulation of chromatin binding	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0060707	trophoblast giant cell differentiation	IEA	biological process
GO:0060711	labyrinthine layer development	IEA	biological process
GO:0060712	spongiotrophoblast layer development	IEA	biological process
GO:0070140	SUMO-specific isopeptidase activity	IEA	molecular function
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0051246	regulation of protein metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0005643	nuclear pore	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005643	nuclear pore	IDA	cellular component
GO:0070139	SUMO-specific endopeptidase activity	IDA	molecular function
GO:0030111	regulation of Wnt signaling pathway	NAS	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray