• Gene id: 59340

Gene Summary

• Gene Symbol: HRH4   Gene   UCSC   Ensembl
• Aliases: AXOR35, BG26, GPCR105, GPRv53, H4, H4R, HH4R
• Gene name: histamine receptor H4
• Alternate names: histamine H4 receptor, G-protein coupled receptor 105, SP9144, pfi-013,
• Gene location: 18q11.2 (24460636: 24479973)     Exons: 3     NC_000018.10
• Gene summary(Entrez): Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by a family of histamine receptors, which are a subset of the G-protein coupled receptor superfamily. This ge
• OMIM: 606792

Protein Summary

• Protein general information: Q9H3N8  
  • Name: Histamine H4 receptor (H4R) (HH4R) (AXOR35) (G protein coupled receptor 105) (GPRv53) (Pfi 013) (SP9144)
  • Length: 390  
  • Mass: 44496
  • Tissue specificity: Expressed primarily in the bone marrow and eosinophils. Shows preferential distribution in cells of immunological relevance such as T-cells, dendritic cells, monocytes, mast cells, neutrophils. Also expressed in a wide variety of perip
• Sequence:

  MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAISDFFVGVISIPLYIPH
  TLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAVSYRTQHTGVLKIVTLMVAVWVLAFLVNGPM
  ILVSESWKDEGSECEPGFFSEWYILAITSFLEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICG
  HSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
  LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPLCHKRFQKAFLKIFCI
  KKQPLPSQHSRSVSS

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR008102  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000256906
• Other Databases: GeneCards:  HRH4  Malacards:  HRH4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006954	inflammatory response	IBA	biological process
GO:0007197	adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway	IBA	biological process
GO:0030594	neurotransmitter receptor activity	IBA	molecular function
GO:0045202	synapse	IBA	cellular component
GO:0004993	G protein-coupled serotonin receptor activity	IBA	molecular function
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA	biological process
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0016907	G protein-coupled acetylcholine receptor activity	IBA	molecular function
GO:0030425	dendrite	IBA	cellular component
GO:0043408	regulation of MAPK cascade	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004969	histamine receptor activity	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004969	histamine receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0098664	G protein-coupled serotonin receptor signaling pathway	IEA	biological process
GO:0008150	biological_process	ND	biological process
GO:0004969	histamine receptor activity	NAS	molecular function
GO:0004969	histamine receptor activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)