• Gene id: 59307

Gene Summary

• Gene Symbol: SIGIRR   Gene   UCSC   Ensembl
• Aliases: IL-1R8, TIR8
• Gene name: single Ig and TIR domain containing
• Alternate names: single Ig IL-1-related receptor, interleukin-1 receptor 8 long isoform, single Ig IL-1R-related molecule, single immunoglobulin and toll-interleukin 1 receptor (TIR) domain, single immunoglobulin domain IL1R1 related, single immunoglobulin domain-containing IL,
• Gene location: 11p15.5 (417453: 405715)     Exons: 11     NC_000011.10
• OMIM: 600006

Protein Summary

• Protein general information: Q6IA17  
  • Name: Single Ig IL 1 related receptor (Single Ig IL 1R related molecule) (Single immunoglobulin domain containing IL1R related protein) (Toll/interleukin 1 receptor 8) (TIR8)
  • Length: 410  
  • Mass: 45679
  • Tissue specificity: Mainly expressed in epithelial tissues such as kidney, lung and gut. {ECO
• Sequence:

  MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANLS
  EVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHVAAVLASLLVLLALLLAALLYVKCRLNVLLWY
  QDAYGEVEINDGKLYDAYVSYSDCPEDRKFVNFILKPQLERRRGYKLFLDDRDLLPRAEPSADLLVNLSRCRRLI
  VVLSDAFLSRAWCSHSFREGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHRHLVTLLLWRPGSVTPSSDFW
  KEVQLALPRKVQYRPVEGDPQTQLQDDKDPMLILRGRVPEGRALDSEVDPDPEGDLGVRGPVFGEPSAPPHTSGV
  SLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM

• Structural information:
  • Protein Domains: (9..10-)
    (/note="Ig-like-C2-type)
    (163..30-)
    (/note="TIR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00204"-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR015621  IPR000157   IPR035897  
  • Prosite: PS50835 PS50104
  • STRING: ENSP00000403104
• Other Databases: GeneCards:  SIGIRR  Malacards:  SIGIRR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006953	acute-phase response	ISS	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031665	negative regulation of lipopolysaccharide-mediated signaling pathway	TAS	biological process
GO:0016020	membrane	IMP	cellular component
GO:0045079	negative regulation of chemokine biosynthetic process	ISS	biological process
GO:0001960	negative regulation of cytokine-mediated signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0071345	cellular response to cytokine stimulus	TAS	biological process
GO:0045079	negative regulation of chemokine biosynthetic process	IEA	biological process
GO:0006953	acute-phase response	IEA	biological process
GO:0001960	negative regulation of cytokine-mediated signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq