• Gene id: 59284

Gene Summary

• Gene Symbol: CACNG7   Gene   UCSC   Ensembl
• Gene name: calcium voltage-gated channel auxiliary subunit gamma 7
• Alternate names: voltage-dependent calcium channel gamma-7 subunit, TARP gamma-7, calcium channel, voltage-dependent, gamma subunit 7, neuronal voltage-gated calcium channel gamma-7 subunit, transmembrane AMPAR regulatory protein gamma-7,
• Gene location: 19q13.42 (64759496: 64881032)     Exons: 18     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a type II transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of th
• OMIM: 606899

Protein Summary

• Protein general information: P62955  
  • Name: Voltage dependent calcium channel gamma 7 subunit (Neuronal voltage gated calcium channel gamma 7 subunit) (Transmembrane AMPAR regulatory protein gamma 7) (TARP gamma 7)
  • Length: 275  
  • Mass: 31003
  • Tissue specificity: Detected in heart left ventricle (PubMed
• Sequence:

  MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWRVCFFAGREKGRCVAS
  EYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLV
  LYISSINDEVMNRPSSSEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCS
  DYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC

• Structural information:
  • Interpro: IPR004031  IPR008371  IPR008368  
  • STRING: ENSP00000375647
• Other Databases: GeneCards:  CACNG7  Malacards:  CACNG7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000311	regulation of AMPA receptor activity	IDA	biological process
GO:0005246	calcium channel regulator activity	IDA	molecular function
GO:1990454	L-type voltage-gated calcium channel complex	IDA	cellular component
GO:0032281	AMPA glutamate receptor complex	ISS	cellular component
GO:0006816	calcium ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0006816	calcium ion transport	IEA	biological process
GO:0005262	calcium channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0061337	cardiac conduction	TAS	biological process
GO:0061337	cardiac conduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0099645	neurotransmitter receptor localization to postsynaptic specialization membrane	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0044300	cerebellar mossy fiber	IEA	cellular component
GO:0043488	regulation of mRNA stability	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:2000311	regulation of AMPA receptor activity	IEA	biological process
GO:1903861	positive regulation of dendrite extension	IEA	biological process
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0032281	AMPA glutamate receptor complex	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005891	voltage-gated calcium channel complex	NAS	cellular component
GO:0006816	calcium ion transport	NAS	biological process
GO:0005245	voltage-gated calcium channel activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04921	Oxytocin signaling pathway
hsa04260	Cardiac muscle contraction
hsa05414	Dilated cardiomyopathy
hsa05410	Hypertrophic cardiomyopathy
hsa05412	Arrhythmogenic right ventricular cardiomyopathy

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq