• Gene id: 5928

Gene Summary

• Gene Symbol: RBBP4   Gene   UCSC   Ensembl
• Aliases: NURF55, RBAP48, lin-53
• Gene name: RB binding protein 4, chromatin remodeling factor
• Alternate names: histone-binding protein RBBP4, CAF-1 subunit C, CAF-I 48 kDa subunit, CAF-I p48, MSI1 protein homolog, RBBP-4, chromatin assembly factor 1 subunit C, chromatin assembly factor I p48 subunit, chromatin assembly factor/CAF-1 p48 subunit, nucleosome-remodeling factor,
• Gene location: 1p35.1 (32651207: 32686210)     Exons: 6     NC_000001.11
• Gene summary(Entrez): This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which
• OMIM: 602923

Protein Summary

• Protein general information: Q09028  
  • Name: Histone binding protein RBBP4 (Chromatin assembly factor 1 subunit C) (CAF 1 subunit C) (Chromatin assembly factor I p48 subunit) (CAF I 48 kDa subunit) (CAF I p48) (Nucleosome remodeling factor subunit RBAP48) (Retinoblastoma binding protein 4) (RBBP 4)
  • Length: 425  
  • Mass: 47656
• Sequence:

  MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDE
  QNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVL
  VFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTG
  HTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVAL
  WDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTA
  KISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS

• Structural information:
  • Interpro: IPR020472  IPR022052  IPR015943  IPR001680  IPR019775   IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • PDB: 2XU7 3GFC 4PBY 4PBZ 4PC0 4R7A 5FXY 5VTB 5WAI 5WAK 5XWR 5XXQ 5Y1U 6BW3 6BW4 6C23 6C24 6G16
  • PDBsum: 2XU7 3GFC 4PBY 4PBZ 4PC0 4R7A 5FXY 5VTB 5WAI 5WAK 5XWR 5XXQ 5Y1U 6BW3 6BW4 6C23 6C24 6G16
  • DIP: 33495
  • STRING: ENSP00000362592
• Other Databases: GeneCards:  RBBP4  Malacards:  RBBP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006336	DNA replication-independent nucleosome assembly	IDA	biological process
GO:0006335	DNA replication-dependent nucleosome assembly	IDA	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0031492	nucleosomal DNA binding	HDA	contributes to
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	HDA	contributes to
GO:0005515	protein binding	IPI	molecular function
GO:0043044	ATP-dependent chromatin remodeling	HDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032991	protein-containing complex	HDA	cellular component
GO:0000790	nuclear chromatin	HDA	cellular component
GO:0006338	chromatin remodeling	IDA	biological process
GO:0008094	DNA-dependent ATPase activity	IDA	contributes to
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0006260	DNA replication	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0045814	negative regulation of gene expression, epigenetic	TAS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0034080	CENP-A containing nucleosome assembly	TAS	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0070317	negative regulation of G0 to G1 transition	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060416	response to growth hormone	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0042393	histone binding	NAS	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0016580	Sin3 complex	NAS	cellular component
GO:0016581	NuRD complex	NAS	cellular component
GO:0016581	NuRD complex	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0035098	ESC/E(Z) complex	IDA	cellular component
GO:0035098	ESC/E(Z) complex	IDA	cellular component
GO:0035098	ESC/E(Z) complex	IDA	cellular component
GO:0033186	CAF-1 complex	IDA	cellular component
GO:0031497	chromatin assembly	IDA	biological process
GO:0016581	NuRD complex	IDA	cellular component
GO:0016589	NURF complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04218	Cellular senescence

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq