• Gene id: 59274

Gene Summary

• Gene Symbol: TLNRD1   Gene   UCSC   Ensembl
• Aliases: MESDC1
• Gene name: talin rod domain containing 1
• Alternate names: talin rod domain-containing protein 1, mesoderm development candidate 1,
• Gene location: 15q25.1 (81000922: 81005787)     Exons: 3     NC_000015.10
• Gene summary(Entrez): This gene encodes a protein that is regulated by micro RNA MiR-574-3, and is thought to have an oncogenic function in human bladder cancer. A similar gene in mouse is located in a chromosomal region critical for differentiation of mesoderm, which affects
• OMIM: 615466

Protein Summary

• Protein general information: Q9H1K6  
  • Name: Talin rod domain containing protein 1 (Mesoderm development candidate 1)
  • Length: 362  
  • Mass: 37758
• Sequence:

  MASGSAGKPTGEAASPAPASAIGGASSQPRKRLVSVCDHCKGKMQLVADLLLLSSEARPVLFEGPASSGAGAESF
  EQCRDTIIARTKGLSILTHDVQSQLNMGRFGEAGDSLVELGDLVVSLTECSAHAAYLAAVATPGAQPAQPGLVDR
  YRVTRCRHEVEQGCAVLRATPLADMTPQLLLEVSQGLSRNLKFLTDACALASDKSRDRFSREQFKLGVKCMSTSA
  SALLACVREVKVAPSELARSRCALFSGPLVQAVSALVGFATEPQFLGRAAAVSAEGKAVQTAILGGAMSVVSACV
  LLTQCLRDLAQHPDGGAKMSDHRERLRNSACAVSEGCTLLSQALRERSSPRTLPPVNSNSVN

• Structural information:
  • Interpro: IPR042799  
  • STRING: ENSP00000267984
• Other Databases: GeneCards:  TLNRD1  Malacards:  TLNRD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003779	actin binding	IBA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0001725	stress fiber	ISS	colocalizes with
GO:0003779	actin binding	ISS	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0001725	stress fiber	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881