• Gene id: 59272

Gene Summary

• Gene Symbol: ACE2   Gene   UCSC   Ensembl
• Aliases: ACEH
• Gene name: angiotensin I converting enzyme 2
• Alternate names: angiotensin-converting enzyme 2, ACE-related carboxypeptidase, angiotensin I converting enzyme (peptidyl-dipeptidase A) 2, angiotensin-converting enzyme homolog, metalloprotease MPROT15, peptidyl-dipeptidase A,
• Gene location: Xp22.2 (15602068: 15494519)     Exons: 21     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I in
• OMIM: 300335

Protein Summary

• Protein general information: Q9BYF1  
  • Name: Angiotensin converting enzyme 2 (EC 3.4.17.23) (ACE related carboxypeptidase) (Angiotensin converting enzyme homolog) (ACEH) (Metalloprotease MPROT15) [Cleaved into: Processed angiotensin converting enzyme 2]
  • Length: 805  
  • Mass: 92,463
• Sequence:

  MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKE
  QSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNE
  IMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIED
  VEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQ
  AWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHE
  MGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTL
  PFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQF
  QEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNK
  NSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANL
  KPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLIVFGVVM
  GVIVVGIVILIFTGIRDRKKKNKARSGENPYASIDISKGENNPGFQNTDDVQTSF

• Structural information:
  • Interpro: IPR031588  IPR001548  
  • Prosite: PS00142
  • CDD: cd06461
  • PDB: 1R42 1R4L 1XJP 2AJF 3D0G 3D0H 3D0I 3KBH 3SCI 3SCJ 3SCK 3SCL
  • PDBsum: 1R42 1R4L 1XJP 2AJF 3D0G 3D0H 3D0I 3KBH 3SCI 3SCJ 3SCK 3SCL
  • DIP: 44689
  • STRING: ENSP00000252519
• Other Databases: GeneCards:  ACE2  Malacards:  ACE2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001618	virus receptor activity	IDA	molecular function
GO:0001618	virus receptor activity	IMP	molecular function
GO:0001817	regulation of cytokine production	IC	biological process
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0002003	angiotensin maturation	TAS	biological process
GO:0002003	angiotensin maturation	TAS	biological process
GO:0002005	angiotensin catabolic process in blood	IC	biological process
GO:0003051	angiotensin-mediated drinking behavior	IMP	biological process
GO:0003081	regulation of systemic arterial blood pressure by renin-angiotensin	IC	biological process
GO:0003081	regulation of systemic arterial blood pressure by renin-angiotensin	IMP	biological process
GO:0004175	endopeptidase activity	IDA	molecular function
GO:0004180	carboxypeptidase activity	IDA	molecular function
GO:0004180	carboxypeptidase activity	IDA	molecular function
GO:0004180	carboxypeptidase activity	IDA	molecular function
GO:0004180	carboxypeptidase activity	IDA	molecular function
GO:0004180	carboxypeptidase activity	IDA	molecular function
GO:0004181	metallocarboxypeptidase activity	EXP	molecular function
GO:0004181	metallocarboxypeptidase activity	EXP	molecular function
GO:0004181	metallocarboxypeptidase activity	EXP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0008270	zinc ion binding	TAS	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0015827	tryptophan transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019229	regulation of vasoconstriction	IC	biological process
GO:0032800	receptor biosynthetic process	IMP	biological process
GO:0042127	regulation of cell proliferation	TAS	biological process
GO:0042312	regulation of vasodilation	IC	biological process
GO:0045121	membrane raft	TAS	cellular component
GO:0046718	viral entry into host cell	TAS	biological process
GO:0046813	receptor-mediated virion attachment to host cell	IDA	biological process
GO:0050727	regulation of inflammatory response	IC	biological process
GO:0060452	positive regulation of cardiac muscle contraction	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:1903598	positive regulation of gap junction assembly	IMP	biological process
GO:1903779	regulation of cardiac conduction	IMP	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IC	biological process
GO:0008237	metallopeptidase activity	IDA	molecular function
GO:0008241	peptidyl-dipeptidase activity	IDA	molecular function
GO:0001618	virus receptor activity	IEA	molecular function
GO:0001618	virus receptor activity	IDA	molecular function
GO:0001618	virus receptor activity	IMP	molecular function
GO:0001817	regulation of cytokine production	IC	biological process
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0002003	angiotensin maturation	TAS	biological process
GO:0002003	angiotensin maturation	TAS	biological process
GO:0002005	angiotensin catabolic process in blood	IC	biological process
GO:0003051	angiotensin-mediated drinking behavior	IMP	biological process
GO:0003081	regulation of systemic arterial blood pressure by renin-angiotensin	IC	biological process
GO:0003081	regulation of systemic arterial blood pressure by renin-angiotensin	IMP	biological process
GO:0004175	endopeptidase activity	IDA	molecular function
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0004180	carboxypeptidase activity	IDA	molecular function
GO:0004180	carboxypeptidase activity	IDA	molecular function
GO:0004180	carboxypeptidase activity	IDA	molecular function
GO:0004180	carboxypeptidase activity	IDA	molecular function
GO:0004180	carboxypeptidase activity	IDA	molecular function
GO:0004181	metallocarboxypeptidase activity	EXP	molecular function
GO:0004181	metallocarboxypeptidase activity	EXP	molecular function
GO:0004181	metallocarboxypeptidase activity	EXP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0008270	zinc ion binding	TAS	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0015827	tryptophan transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0019229	regulation of vasoconstriction	IC	biological process
GO:0032800	receptor biosynthetic process	IMP	biological process
GO:0042127	regulation of cell proliferation	TAS	biological process
GO:0042312	regulation of vasodilation	IC	biological process
GO:0045121	membrane raft	TAS	cellular component
GO:0046718	viral entry into host cell	TAS	biological process
GO:0046813	receptor-mediated virion attachment to host cell	IDA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0050727	regulation of inflammatory response	IC	biological process
GO:0060452	positive regulation of cardiac muscle contraction	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:1903598	positive regulation of gap junction assembly	IMP	biological process
GO:1903779	regulation of cardiac conduction	IMP	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IC	biological process
GO:0008237	metallopeptidase activity	IDA	molecular function
GO:0008241	peptidyl-dipeptidase activity	IDA	molecular function
GO:0001618	virus receptor activity	IDA	molecular function
GO:0001618	virus receptor activity	IMP	molecular function
GO:0001817	regulation of cytokine production	IC	biological process
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0002003	angiotensin maturation	TAS	biological process
GO:0002003	angiotensin maturation	TAS	biological process
GO:0002005	angiotensin catabolic process in blood	IC	biological process
GO:0003051	angiotensin-mediated drinking behavior	IMP	biological process
GO:0003081	regulation of systemic arterial blood pressure by renin-angiotensin	IC	biological process
GO:0003081	regulation of systemic arterial blood pressure by renin-angiotensin	IMP	biological process
GO:0004175	endopeptidase activity	IDA	molecular function
GO:0004180	carboxypeptidase activity	IDA	molecular function
GO:0004180	carboxypeptidase activity	IDA	molecular function
GO:0004180	carboxypeptidase activity	IDA	molecular function
GO:0004180	carboxypeptidase activity	IDA	molecular function
GO:0004180	carboxypeptidase activity	IDA	molecular function
GO:0004181	metallocarboxypeptidase activity	EXP	molecular function
GO:0004181	metallocarboxypeptidase activity	EXP	molecular function
GO:0004181	metallocarboxypeptidase activity	EXP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0008270	zinc ion binding	TAS	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0019229	regulation of vasoconstriction	IC	biological process
GO:0032800	receptor biosynthetic process	IMP	biological process
GO:0042127	regulation of cell proliferation	TAS	biological process
GO:0042312	regulation of vasodilation	IC	biological process
GO:0045121	membrane raft	TAS	cellular component
GO:0046718	viral entry into host cell	TAS	biological process
GO:0046813	receptor-mediated virion attachment to host cell	IDA	biological process
GO:0050727	regulation of inflammatory response	IC	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:1903598	positive regulation of gap junction assembly	IMP	biological process
GO:1903779	regulation of cardiac conduction	IMP	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IC	biological process
GO:0008237	metallopeptidase activity	IDA	molecular function
GO:0008241	peptidyl-dipeptidase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04614	Renin-angiotensin system
hsa04974	Protein digestion and absorption

Diseases

Associated diseases	References
Atrial fibrillation	GAD: 18496132
Cardiovascular disease	GAD: 18926157
Hypertension	GAD: 16215952
Sarcoidosis	GAD: 16215952
Diabetes	GAD: 16211375
Polycystic ovary syndrome (PCOS)	INFBASE: 24169251
Male factor infertility	MIK: 20361351
Spermatogenesis defects	MIK: 20361351
Female infertility	INFBASE: 24169251
Pulmonary fibrosis	GAD: 16215952
Pulmonary fibrosis	GAD: 16315782
Male infertility, impaired spermatogenesis (non-obstructive azoospermia)	MIK: 20361351

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20361351	Male infertility, impaired spermatogenesis (non-obstructive azoospermia)			20 (8 with obstructive azoospermia/normal spermatogenesis, 12 with non-obstructive azoospermia and severely impaired spermatogenesis)	Male infertility	ACE2