• Gene id: 5923

Gene Summary

• Gene Symbol: RASGRF1   Gene   UCSC   Ensembl
• Aliases: CDC25, CDC25L, GNRP, GRF1, GRF55, H-GRF55, PP13187, ras-GRF1
• Gene name: Ras protein specific guanine nucleotide releasing factor 1
• Alternate names: ras-specific guanine nucleotide-releasing factor 1, Ras-specific guanine nucleotide-releasing factor, CDC25 homolog, Ras-specific nucleotide exchange factor CDC25, guanine nucleotide exchange factor, guanine nucleotide-releasing factor 1, guanine nucleotide-re,
• Gene location: 15q25.1 (79090779: 78959905)     Exons: 30     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene is a guanine nucleotide exchange factor (GEF) similar to the Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated that this protein stimulates the dissociation of GDP from RAS protein. The stud
• OMIM: 605478

Protein Summary

• Protein general information: Q13972  
  • Name: Ras specific guanine nucleotide releasing factor 1 (Ras GRF1) (Guanine nucleotide releasing protein) (GNRP) (Ras specific nucleotide exchange factor CDC25)
  • Length: 1273  
  • Mass: 145234
• Sequence:

  MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSSRPSGLYLLEGCVCDR
  APSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEWVAAIAHASYRTLATEHEALMQKYLHLLQIV
  ETEKTVAKQLRQQIEDGEIEIERLKAEITSLLKDNERIQSTQTVAPNDEDSDIKKIKKVQSFLRGWLCRRKWKTI
  IQDYIRSPHADSMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
  QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLLKHYEAKPDCEERTLE
  TFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELSRIMHDEVSETENIRKNLAIERMIIEGCEIL
  LDTSQTFVRQGSLIQVPMSEKGKITRGRLGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTL
  LEEPESTEEEAKGSGQDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
  KVTVPQMIKRTREGTREAEMSRSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFL
  HSYRVFTTAIVVLDKLITIYKKPISAIPARWLRSLELLFASGQNNKLLYGEPPKSPRATRKFSSPPPLSITKTSS
  PSRRRKLSLNIPIITGGKALDLAALSCNSNGYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPED
  PSALSKQSSEVSMREESDIDQNQSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNGVVMTSCRELDNNRSAL
  SAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDEL
  KCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFENHSALEIAEQLTLLD
  HLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHN
  YNAVLEITSSMNRSAIFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFI
  EEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPKLPT

• Structural information:
  • Protein Domains: (22..12-)
    (/note="PH-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (204..22-)
    (/note="IQ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00116-)
    (240..42-)
    (/note="DH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00062-)
    (467.-)
  • Interpro: IPR035899  IPR000219  IPR001331  IPR000048  IPR011993   IPR001849  IPR008937  IPR000651  IPR019804  IPR023578  IPR001895  IPR036964  IPR030745  
  • Prosite: PS00741 PS50010 PS50096 PS50003 PS00720 PS50009 PS50212
  • CDD: cd00155 cd06224 cd00160
  • STRING: ENSP00000405963
• Other Databases: GeneCards:  RASGRF1  Malacards:  RASGRF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046579	positive regulation of Ras protein signal transduction	TAS	biological process
GO:0046578	regulation of Ras protein signal transduction	ISS	biological process
GO:0031175	neuron projection development	ISS	biological process
GO:0005829	cytosol	ISS	cellular component
GO:0090630	activation of GTPase activity	ISS	biological process
GO:0043547	positive regulation of GTPase activity	ISS	biological process
GO:0030426	growth cone	ISS	cellular component
GO:0035020	regulation of Rac protein signal transduction	ISS	biological process
GO:0048167	regulation of synaptic plasticity	ISS	biological process
GO:0046579	positive regulation of Ras protein signal transduction	ISS	biological process
GO:0046578	regulation of Ras protein signal transduction	IEA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0035023	regulation of Rho protein signal transduction	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005085	guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005088	Ras guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0090630	activation of GTPase activity	IEA	biological process
GO:0048168	regulation of neuronal synaptic plasticity	IEA	biological process
GO:0046578	regulation of Ras protein signal transduction	IEA	biological process
GO:0035254	glutamate receptor binding	IEA	molecular function
GO:0031175	neuron projection development	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:2000310	regulation of NMDA receptor activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0035020	regulation of Rac protein signal transduction	IEA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0008283	cell population proliferation	IEA	biological process
GO:0005088	Ras guanyl-nucleotide exchange factor activity	IMP	molecular function
GO:0034976	response to endoplasmic reticulum stress	IMP	biological process
GO:0043005	neuron projection	NAS	cellular component
GO:0007616	long-term memory	NAS	biological process
GO:0005886	plasma membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04510	Focal adhesion

Diseases

Associated diseases	References
Temporal lobe epilepsy	PMID:23200899
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray