• Gene id: 5919

Gene Summary

• Gene Symbol: RARRES2   Gene   UCSC   Ensembl
• Aliases: HP10433, TIG2
• Gene name: retinoic acid receptor responder 2
• Alternate names: retinoic acid receptor responder protein 2, RAR-responsive protein TIG2, chemerin, retinoic acid receptor responder (tazarotene induced) 2, tazarotene-induced gene 2 protein,
• Gene location: 7q36.1 (150341684: 150338328)     Exons: 6     NC_000007.14
• Gene summary(Entrez): This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tis
• OMIM: 312070

Protein Summary

• Protein general information: Q99969  
  • Name: Retinoic acid receptor responder protein 2 (Chemerin) (RAR responsive protein TIG2) (Tazarotene induced gene 2 protein)
  • Length: 163  
  • Mass: 18618
  • Tissue specificity: Expressed at the highest levels in placenta, liver, and white adipose tissue (WAT), and to a lesser extent in many other tissues such as lung, brown adipose tissue, heart, ovary, kidney, skeletal muscle and pancreas. Within WAT, expres
• Sequence:

  MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQT
  SCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYF
  PGQFAFSKALPRS

• Structural information:
  • Interpro: IPR029562  
  • STRING: ENSP00000418009
• Other Databases: GeneCards:  RARRES2  Malacards:  RARRES2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050921	positive regulation of chemotaxis	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0031012	extracellular matrix	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0050994	regulation of lipid catabolic process	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0010759	positive regulation of macrophage chemotaxis	IMP	biological process
GO:0048566	embryonic digestive tract development	IMP	biological process
GO:0008286	insulin receptor signaling pathway	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0050921	positive regulation of chemotaxis	ISS	biological process
GO:0045600	positive regulation of fat cell differentiation	ISS	biological process
GO:0005576	extracellular region	ISS	cellular component
GO:0050994	regulation of lipid catabolic process	ISS	biological process
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0050994	regulation of lipid catabolic process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0031089	platelet dense granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0062023	collagen-containing extracellular matrix	IDA	cellular component
GO:0001523	retinoid metabolic process	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0050830	defense response to Gram-positive bacterium	IMP	biological process
GO:0061760	antifungal innate immune response	IMP	biological process
GO:0045087	innate immune response	IMP	biological process
GO:0050829	defense response to Gram-negative bacterium	IMP	biological process
GO:0050830	defense response to Gram-positive bacterium	IMP	biological process
GO:0019732	antifungal humoral response	IMP	biological process
GO:0050829	defense response to Gram-negative bacterium	IMP	biological process

Diseases

Associated diseases	References
Non-alcoholic fatty liver disease	PMID:23507574
Essential hypertension	PMID:24047472
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray