• Gene id: 5916

Gene Summary

• Gene Symbol: RARG   Gene   UCSC   Ensembl
• Aliases: NR1B3, RARC
• Gene name: retinoic acid receptor gamma
• Alternate names: retinoic acid receptor gamma, RAR-gamma, nuclear receptor subfamily 1 group B member 3, retinoic acid nuclear receptor gamma variant 1, retinoic acid nuclear receptor gamma variant 2,
• Gene location: 12q13.13 (53232255: 53210565)     Exons: 12     NC_000012.12
• Gene summary(Entrez): This gene encodes a retinoic acid receptor that belongs to the nuclear hormone receptor family. Retinoic acid receptors (RARs) act as ligand-dependent transcriptional regulators. When bound to ligands, RARs activate transcription by binding as heterodimer

Protein Summary

• Protein general information: P13631  
  • Name: Retinoic acid receptor gamma (RAR gamma) (Nuclear receptor subfamily 1 group B member 3)
  • Length: 454  
  • Mass: 50342
  • Tissue specificity: Expressed in aortic endothelial cells (at protein level). {ECO
• Sequence:

  MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVP
  SSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKC
  FEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLG
  LWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH
  NAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYM
  FPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGL
  KSPA

• Structural information:
  • Protein Domains: (185..41-)
    (/note="NR-LBD)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01189"-)
  • Interpro: IPR035500  IPR000536  IPR001723  IPR003078  IPR001628   IPR013088  
  • Prosite: PS51843 PS00031 PS51030
  • PDB: 1EXA 1EXX 1FCX 1FCY 1FCZ 1FD0 2LBD 3LBD 4LBD 5M24 6FX0
  • PDBsum: 1EXA 1EXX 1FCX 1FCY 1FCZ 1FD0 2LBD 3LBD 4LBD 5M24 6FX0
  • STRING: ENSP00000388510
• Other Databases: GeneCards:  RARG  Malacards:  RARG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0090575	RNA polymerase II transcription regulator complex	IBA	cellular component
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0009755	hormone-mediated signaling pathway	IBA	biological process
GO:0004879	nuclear receptor activity	IBA	molecular function
GO:0048384	retinoic acid receptor signaling pathway	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0008134	transcription factor binding	IBA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003707	steroid hormone receptor activity	IEA	molecular function
GO:0004879	nuclear receptor activity	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0042025	host cell nucleus	IEA	cellular component
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0048384	retinoic acid receptor signaling pathway	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004879	nuclear receptor activity	IEA	molecular function
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0002063	chondrocyte development	IEA	biological process
GO:0003417	growth plate cartilage development	IEA	biological process
GO:0003430	growth plate cartilage chondrocyte growth	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0009952	anterior/posterior pattern specification	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0043068	positive regulation of programmed cell death	IEA	biological process
GO:0045596	negative regulation of cell differentiation	IEA	biological process
GO:0048732	gland development	IEA	biological process
GO:0060324	face development	IEA	biological process
GO:0070384	Harderian gland development	IEA	biological process
GO:0031641	regulation of myelination	IEA	biological process
GO:0048384	retinoic acid receptor signaling pathway	IEA	biological process
GO:0071300	cellular response to retinoic acid	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0000790	nuclear chromatin	IEA	cellular component
GO:0001843	neural tube closure	IEA	biological process
GO:0002068	glandular epithelial cell development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0010468	regulation of gene expression	IEA	biological process
GO:0031076	embryonic camera-type eye development	IEA	biological process
GO:0032331	negative regulation of chondrocyte differentiation	IEA	biological process
GO:0035116	embryonic hindlimb morphogenesis	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0045637	regulation of myeloid cell differentiation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0046965	retinoid X receptor binding	IEA	molecular function
GO:0048048	embryonic eye morphogenesis	IEA	biological process
GO:0048384	retinoic acid receptor signaling pathway	IEA	biological process
GO:0048608	reproductive structure development	IEA	biological process
GO:0060173	limb development	IEA	biological process
GO:0060348	bone development	IEA	biological process
GO:0060349	bone morphogenesis	IEA	biological process
GO:0060429	epithelium development	IEA	biological process
GO:0060534	trachea cartilage development	IEA	biological process
GO:0060740	prostate gland epithelium morphogenesis	IEA	biological process
GO:0061037	negative regulation of cartilage development	IEA	biological process
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	ISS	molecular function
GO:0003677	DNA binding	ISS	molecular function
GO:0046965	retinoid X receptor binding	ISS	molecular function
GO:0008285	negative regulation of cell population proliferation	ISS	biological process
GO:0008361	regulation of cell size	TAS	biological process
GO:0043068	positive regulation of programmed cell death	ISS	biological process
GO:0032526	response to retinoic acid	IDA	biological process
GO:0048384	retinoic acid receptor signaling pathway	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0005667	transcription regulator complex	ISS	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0035116	embryonic hindlimb morphogenesis	ISS	biological process
GO:0043065	positive regulation of apoptotic process	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0048048	embryonic eye morphogenesis	ISS	biological process
GO:0060070	canonical Wnt signaling pathway	TAS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq