• Gene id: 5912

Gene Summary

• Gene Symbol: RAP2B   Gene   UCSC   Ensembl
• Gene name: RAP2B, member of RAS oncogene family
• Alternate names: ras-related protein Rap-2b, small GTP binding protein,
• Gene location: 3q25.2 (153162225: 153170626)     Exons: 1     NC_000003.12
• Gene summary(Entrez): This intronless gene belongs to a family of RAS-related genes. The proteins encoded by these genes share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. The most striking difference be
• OMIM: 179541

Protein Summary

• Protein general information: P61225  
  • Name: Ras related protein Rap 2b
  • Length: 183  
  • Mass: 20504
  • Tissue specificity: Expressed in red blood cells (at protein level). {ECO
• Sequence:

  MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNG
  QGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNK
  ASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL

• Structural information:
  • Interpro: IPR027417  IPR041840  IPR005225  IPR001806  IPR020849  
  • Prosite: PS51421
  • CDD: cd04176
  • PDB: 1N4P 1N4Q 1N4R
  • PDBsum: 1N4P 1N4Q 1N4R
  • STRING: ENSP00000319096
• Other Databases: GeneCards:  RAP2B  Malacards:  RAP2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0032486	Rap protein signal transduction	IBA	biological process
GO:0005525	GTP binding	IBA	molecular function
GO:0019003	GDP binding	IBA	molecular function
GO:0030336	negative regulation of cell migration	IBA	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0061097	regulation of protein tyrosine kinase activity	ISS	biological process
GO:0055038	recycling endosome membrane	ISS	cellular component
GO:0032486	Rap protein signal transduction	ISS	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0032486	Rap protein signal transduction	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005525	GTP binding	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032486	Rap protein signal transduction	IEA	biological process
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0061097	regulation of protein tyrosine kinase activity	IEA	biological process
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0055037	recycling endosome	IEA	cellular component
GO:0031954	positive regulation of protein autophosphorylation	IEA	biological process
GO:0030336	negative regulation of cell migration	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0019003	GDP binding	IDA	molecular function
GO:0005525	GTP binding	IDA	molecular function
GO:0030168	platelet activation	IDA	biological process
GO:0005525	GTP binding	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0070527	platelet aggregation	IDA	biological process
GO:0005923	bicellular tight junction	IDA	cellular component
GO:0044291	cell-cell contact zone	IDA	cellular component
GO:0016020	membrane	IMP	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0045121	membrane raft	IMP	cellular component
GO:0030033	microvillus assembly	IMP	NOT|biological process
GO:0090557	establishment of endothelial intestinal barrier	IMP	NOT|biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)