• Gene id: 5911

Gene Summary

• Gene Symbol: RAP2A   Gene   UCSC   Ensembl
• Aliases: K-REV, KREV, RAP2, RbBP-30
• Gene name: RAP2A, member of RAS oncogene family
• Alternate names: ras-related protein Rap-2a, RAP2, member of RAS oncogene family (K-rev),
• Gene location: 13q32.1 (97434168: 97469127)     Exons: 2     NC_000013.11
• OMIM: 609188

Protein Summary

• Protein general information: P10114  
  • Name: Ras related protein Rap 2a (RbBP 30)
  • Length: 183  
  • Mass: 20615
• Sequence:

  MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNG
  QGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSK
  TMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ

• Structural information:
  • Interpro: IPR027417  IPR041840  IPR005225  IPR001806  IPR020849  
  • Prosite: PS51421
  • CDD: cd04176
  • PDB: 1KAO 2RAP 3RAP
  • PDBsum: 1KAO 2RAP 3RAP
  • STRING: ENSP00000245304
• Other Databases: GeneCards:  RAP2A  Malacards:  RAP2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032486	Rap protein signal transduction	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0030336	negative regulation of cell migration	IBA	biological process
GO:0019003	GDP binding	IBA	molecular function
GO:0005525	GTP binding	IBA	molecular function
GO:0003924	GTPase activity	IBA	molecular function
GO:0055038	recycling endosome membrane	IDA	cellular component
GO:0046328	regulation of JNK cascade	IDA	biological process
GO:0031954	positive regulation of protein autophosphorylation	IDA	biological process
GO:0003924	GTPase activity	IDA	molecular function
GO:0048814	regulation of dendrite morphogenesis	IDA	biological process
GO:0034613	cellular protein localization	IDA	biological process
GO:0031532	actin cytoskeleton reorganization	IDA	biological process
GO:0032486	Rap protein signal transduction	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0032486	Rap protein signal transduction	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055037	recycling endosome	IDA	cellular component
GO:0045184	establishment of protein localization	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0032486	Rap protein signal transduction	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0030336	negative regulation of cell migration	IEA	biological process
GO:0031954	positive regulation of protein autophosphorylation	IEA	biological process
GO:0055037	recycling endosome	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0000287	magnesium ion binding	IMP	molecular function
GO:0000287	magnesium ion binding	IMP	molecular function
GO:0005525	GTP binding	IMP	molecular function
GO:0005525	GTP binding	IMP	molecular function
GO:0019003	GDP binding	IMP	molecular function
GO:0035690	cellular response to drug	IDA	biological process
GO:0055037	recycling endosome	IDA	cellular component
GO:0005525	GTP binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0030033	microvillus assembly	IMP	biological process
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0045198	establishment of epithelial cell apical/basal polarity	IMP	NOT|biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881