• Gene id: 59084

Gene Summary

• Gene Symbol: ENPP5   Gene   UCSC   Ensembl
• Aliases: NPP-5, NPP5
• Gene name: ectonucleotide pyrophosphatase/phosphodiesterase family member 5
• Alternate names: ectonucleotide pyrophosphatase/phosphodiesterase family member 5, E-NPP 5, ectonucleotide pyrophosphatase/phosphodiesterase 5 (putative),
• Gene location: 6p21.1 (46171009: 46159181)     Exons: 5     NC_000006.12
• Gene summary(Entrez): This gene encodes a type-I transmembrane glycoprotein. Studies in rat suggest the encoded protein may play a role in neuronal cell communications. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2014]
• OMIM: 0

Protein Summary

• Protein general information: Q9UJA9  
  • Name: Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 (E NPP 5) (NPP 5) (EC 3.1. . )
  • Length: 477  
  • Mass: 54666
• Sequence:

  MTSKFLLVSFILAALSLSTTFSLQPDQQKVLLVSFDGFRWDYLYKVPTPHFHYIMKYGVHVKQVTNVFITKTYPN
  HYTLVTGLFAENHGIVANDMFDPIRNKSFSLDHMNIYDSKFWEEATPIWITNQRAGHTSGAAMWPGTDVKIHKRF
  PTHYMPYNESVSFEDRVAKIIEWFTSKEPINLGLLYWEDPDDMGHHLGPDSPLMGPVISDIDKKLGYLIQMLKKA
  KLWNTLNLIITSDHGMTQCSEERLIELDQYLDKDHYTLIDQSPVAAILPKEGKFDEVYEALTHAHPNLTVYKKED
  VPERWHYKYNSRIQPIIAVADEGWHILQNKSDDFLLGNHGYDNALADMHPIFLAHGPAFRKNFSKEAMNSTDLYP
  LLCHLLNITAMPHNGSFWNVQDLLNSAMPRVVPYTQSTILLPGSVKPAEYDQEGSYPYFIGVSLGSIIVIVFFVI
  FIKHLIHSQIPALQDMHAEIAQPLLQA

• Structural information:
  • Interpro: IPR017850  IPR002591  
  • PDB: 5VEM
  • PDBsum: 5VEM
  • STRING: ENSP00000360436
• Other Databases: GeneCards:  ENPP5  Malacards:  ENPP5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003824	catalytic activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007154	cell communication	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881