• Gene id: 59082

Gene Summary

• Gene Symbol: CARD18   Gene   UCSC   Ensembl
• Aliases: ICEBERG, UNQ5804, pseudo-ICE
• Gene name: caspase recruitment domain family member 18
• Alternate names: caspase recruitment domain-containing protein 18, ICEBERG caspase-1 inhibitor, caspase-1 inhibitor Iceberg,
• Gene location: 11q22.3 (105139768: 105137713)     Exons: 3     NC_000011.10
• OMIM: 605354

Protein Summary

• Protein general information: P57730  
  • Name: Caspase recruitment domain containing protein 18 (Caspase 1 inhibitor Iceberg)
  • Length: 90  
  • Mass: 10138
  • Tissue specificity: Primarily expressed in the heart and placenta. {ECO
• Sequence:

  MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKH
  LCEEDPQLASKMGLH

• Structural information:
  • Protein Domains: (1..9-)
    (/note="CARD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00046"-)
  • Interpro: IPR001315  IPR011029  
  • Prosite: PS50209
  • PDB: 1DGN
  • PDBsum: 1DGN
  • DIP: 41317
  • STRING: ENSP00000436691
• Other Databases: GeneCards:  CARD18  Malacards:  CARD18

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0089720	caspase binding	IBA	molecular function
GO:0032991	protein-containing complex	IBA	cellular component
GO:0050713	negative regulation of interleukin-1 beta secretion	IBA	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0004869	cysteine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097340	inhibition of cysteine-type endopeptidase activity	IDA	biological process
GO:0050713	negative regulation of interleukin-1 beta secretion	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0050713	negative regulation of interleukin-1 beta secretion	IDA	biological process
GO:0006954	inflammatory response	NAS	biological process
GO:0050700	CARD domain binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0089720	caspase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04621	NOD-like receptor signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)