• Gene id: 5908

Gene Summary

• Gene Symbol: RAP1B   Gene   UCSC   Ensembl
• Aliases: K-REV, RAL1B
• Gene name: RAP1B, member of RAS oncogene family
• Alternate names: ras-related protein Rap-1b, GTP-binding protein smg p21B, RAS-related protein RAP1B, Ras family small GTP binding protein RAP1B, small GTP binding protein,
• Gene location: 12q15 (68610898: 68671900)     Exons: 8     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the RAS-like small GTP-binding protein superfamily. Members of this family regulate multiple cellular processes including cell adhesion and growth and differentiation. This protein localizes to cellular membranes and has been
• OMIM: 157129

Protein Summary

• Protein general information: P61224  
  • Name: Ras related protein Rap 1b (GTP binding protein smg p21B)
  • Length: 184  
  • Mass: 20825
• Sequence:

  MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNG
  QGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKS
  KINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL

• Structural information:
  • Interpro: IPR027417  IPR038851  IPR005225  IPR001806  IPR020849  
  • Prosite: PS51421
  • CDD: cd04175
  • PDB: 3BRW 3CF6 4DXA 4HDO 4HDQ 4M8N 4MGI 4MGK 4MGY 4MGZ 4MH0 5KHO 6AXF 6BA6 6KYK
  • PDBsum: 3BRW 3CF6 4DXA 4HDO 4HDQ 4M8N 4MGI 4MGK 4MGY 4MGZ 4MH0 5KHO 6AXF 6BA6 6KYK
  • DIP: 35407
  • STRING: ENSP00000250559
• Other Databases: GeneCards:  RAP1B  Malacards:  RAP1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033625	positive regulation of integrin activation	IMP	biological process
GO:2000301	negative regulation of synaptic vesicle exocytosis	IBA	biological process
GO:0071320	cellular response to cAMP	IBA	biological process
GO:0019003	GDP binding	IBA	molecular function
GO:0005525	GTP binding	IBA	molecular function
GO:0003924	GTPase activity	IBA	molecular function
GO:0032486	Rap protein signal transduction	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0071320	cellular response to cAMP	IDA	biological process
GO:0019003	GDP binding	IDA	molecular function
GO:0005911	cell-cell junction	IDA	cellular component
GO:0005525	GTP binding	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:2000114	regulation of establishment of cell polarity	IMP	biological process
GO:1901888	regulation of cell junction assembly	IMP	biological process
GO:0061028	establishment of endothelial barrier	IMP	biological process
GO:0032486	Rap protein signal transduction	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0032486	Rap protein signal transduction	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0035722	interleukin-12-mediated signaling pathway	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005622	intracellular	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045955	negative regulation of calcium ion-dependent exocytosis	IEA	biological process
GO:2000301	negative regulation of synaptic vesicle exocytosis	IEA	biological process
GO:0009743	response to carbohydrate	IEA	biological process
GO:0035690	cellular response to drug	IEA	biological process
GO:0097211	cellular response to gonadotropin-releasing hormone	IEA	biological process
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0008283	cell population proliferation	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0045121	membrane raft	IDA	NOT|cellular component
GO:0005811	lipid droplet	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0030033	microvillus assembly	IMP	NOT|biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa04024	cAMP signaling pathway
hsa04062	Chemokine signaling pathway
hsa04510	Focal adhesion
hsa04934	Cushing syndrome
hsa04611	Platelet activation
hsa04722	Neurotrophin signaling pathway
hsa04670	Leukocyte transendothelial migration
hsa04972	Pancreatic secretion
hsa04720	Long-term potentiation
hsa05211	Renal cell carcinoma

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray