• Gene id: 59067

Gene Summary

• Gene Symbol: IL21   Gene   UCSC   Ensembl
• Aliases: CVID11, IL-21, Za11
• Gene name: interleukin 21
• Alternate names: interleukin-21, interleukin-21 isoform,
• Gene location: 4q27 (122621056: 122612627)     Exons: 5     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multi
• OMIM: 605384

Protein Summary

• Protein general information: Q9HBE4  
  • Name: Interleukin 21 (IL 21) (Za11)
  • Length: 155  
  • Mass: 17,923
• Sequence:

  MERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKA
  QLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTH
  GSEDS

• Structural information:
  • Interpro: IPR009079  IPR003443  IPR038327  IPR028151  
  • PDB: 2OQP 3TGX
  • PDBsum: 2OQP 3TGX
  • STRING: ENSP00000264497
• Other Databases: GeneCards:  IL21  Malacards:  IL21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001819	positive regulation of cytokine production	IDA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005126	cytokine receptor binding	TAS	molecular function
GO:0005134	interleukin-2 receptor binding	IPI	molecular function
GO:0005615	extracellular space	NAS	cellular component
GO:0005622	intracellular	IEA	cellular component
GO:0006955	immune response	IEA	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0030890	positive regulation of B cell proliferation	IDA	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0034105	positive regulation of tissue remodeling	IC	biological process
GO:0042102	positive regulation of T cell proliferation	IDA	biological process
GO:0042102	positive regulation of T cell proliferation	IDA	biological process
GO:0042503	tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0042511	positive regulation of tyrosine phosphorylation of Stat1 protein	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0045078	positive regulation of interferon-gamma biosynthetic process	NAS	biological process
GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	IDA	biological process
GO:0048469	cell maturation	IDA	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0001819	positive regulation of cytokine production	IDA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005126	cytokine receptor binding	IEA	molecular function
GO:0005126	cytokine receptor binding	TAS	molecular function
GO:0005134	interleukin-2 receptor binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	NAS	cellular component
GO:0005622	intracellular	IEA	cellular component
GO:0006955	immune response	IEA	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0030890	positive regulation of B cell proliferation	IDA	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0034105	positive regulation of tissue remodeling	IC	biological process
GO:0042102	positive regulation of T cell proliferation	IDA	biological process
GO:0042102	positive regulation of T cell proliferation	IDA	biological process
GO:0042503	tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0042511	positive regulation of tyrosine phosphorylation of Stat1 protein	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0045078	positive regulation of interferon-gamma biosynthetic process	NAS	biological process
GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	IDA	biological process
GO:0048469	cell maturation	IDA	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0001819	positive regulation of cytokine production	IDA	biological process
GO:0005126	cytokine receptor binding	TAS	molecular function
GO:0005134	interleukin-2 receptor binding	IPI	molecular function
GO:0005615	extracellular space	NAS	cellular component
GO:0007165	signal transduction	NAS	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0030890	positive regulation of B cell proliferation	IDA	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0034105	positive regulation of tissue remodeling	IC	biological process
GO:0042102	positive regulation of T cell proliferation	IDA	biological process
GO:0042102	positive regulation of T cell proliferation	IDA	biological process
GO:0042503	tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0042511	positive regulation of tyrosine phosphorylation of Stat1 protein	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0045078	positive regulation of interferon-gamma biosynthetic process	NAS	biological process
GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	IDA	biological process
GO:0048469	cell maturation	IDA	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04659	Th17 cell differentiation
hsa05321	Inflammatory bowel disease

Diseases

Associated diseases	References
Arthritis	GAD: 19404967
Asthma	GAD: 18802358
Autoimmune diseases	GAD: 20962850
Celiac disease	GAD: 17558408
Crohn's disease	GAD: 19201773
Ulcerative colitis	GAD: 19201773
Multiple sclerosis	GAD: 19523143
Systemic lupus erythematosus (SLE)	GAD: 17720724
Immunodeficiency	OMIM: 605384
Addison's disease	GAD: 18593762
Diabetes	GAD: 17462506
Diabetes	KEGG: H00408
Unexplained infertility	MIK: 25032981
Immunoinfertility	MIK: 25032981
Wegener granulomatosis	GAD: 20049410
Unexplained infertility	MIK: 25032981

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25032981	Unexplained infertility			50 (30 with immune infertility, 20 controls)	Male infertility, Female infertility	IL-21 IL-12 and TNF?