• Gene id: 5905

Gene Summary

• Gene Symbol: RANGAP1   Gene   UCSC   Ensembl
• Aliases: Fug1, RANGAP, SD
• Gene name: Ran GTPase activating protein 1
• Alternate names: ran GTPase-activating protein 1, segregation distorter homolog, segregation distortion,
• Gene location: 22q13.2 (41302212: 41244776)     Exons: 25     NC_000022.11
• Gene summary(Entrez): This gene encodes a protein that associates with the nuclear pore complex and participates in the regulation of nuclear transport. The encoded protein interacts with Ras-related nuclear protein 1 (RAN) and regulates guanosine triphosphate (GTP)-binding an
• OMIM: 602362

Protein Summary

• Protein general information: P46060  
  • Name: Ran GTPase activating protein 1 (RanGAP1)
  • Length: 587  
  • Mass: 63,542
• Sequence:

  MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEK
  KSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLN
  NCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGINHPGI
  TALAQAFAVNPLLRVINLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAIRGGLPKLKELNL
  SFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNMAKVLASLSDDEDEEEEEEGEEEEEE
  AEEEEEEDEEEEEEEEEEEEEEPQQRGQGEKSATPSRKILDPNTGEPAPVLSSPPPADVSTFLAFPSPEKLLRLG
  PKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKS
  EDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV

• Structural information:
  • Interpro: IPR001611  IPR032675  IPR009109  IPR027038  IPR036720  
  • PDB: 1Z5S 2GRN 2GRO 2GRP 2GRQ 2GRR 2IO2 2IO3 2IY0 3UIN 3UIO 3UIP 5D2M
  • PDBsum: 1Z5S 2GRN 2GRO 2GRP 2GRQ 2GRR 2IO2 2IO3 2IY0 3UIN 3UIO 3UIP 5D2M
  • DIP: 29079
  • STRING: ENSP00000348577
• Other Databases: GeneCards:  RANGAP1  Malacards:  RANGAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005643	nuclear pore	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007062	sister chromatid cohesion	TAS	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0008536	Ran GTPase binding	IEA	molecular function
GO:0016925	protein sumoylation	TAS	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0031965	nuclear membrane	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0044614	nuclear pore cytoplasmic filaments	IEA	cellular component
GO:0046826	negative regulation of protein export from nucleus	IDA	biological process
GO:0048678	response to axon injury	IEA	biological process
GO:0072686	mitotic spindle	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:1904117	cellular response to vasopressin	IEA	biological process
GO:1990723	cytoplasmic periphery of the nuclear pore complex	IEA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0000776	kinetochore	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005096	GTPase activator activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005643	nuclear pore	IEA	cellular component
GO:0005643	nuclear pore	TAS	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007062	sister chromatid cohesion	TAS	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0008536	Ran GTPase binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016925	protein sumoylation	TAS	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0031965	nuclear membrane	IEA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0044614	nuclear pore cytoplasmic filaments	IEA	cellular component
GO:0046826	negative regulation of protein export from nucleus	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048678	response to axon injury	IEA	biological process
GO:0071375	cellular response to peptide hormone stimulus	IEA	biological process
GO:0072686	mitotic spindle	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:1904117	cellular response to vasopressin	IEA	biological process
GO:1990723	cytoplasmic periphery of the nuclear pore complex	IEA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0005096	GTPase activator activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005643	nuclear pore	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007062	sister chromatid cohesion	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0031965	nuclear membrane	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0046826	negative regulation of protein export from nucleus	IDA	biological process
GO:0000776	kinetochore	IDA	cellular component

Diseases

Associated diseases	References
Poor sperm motility	MIK: 25118297
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Poor sperm motility	MIK: 25118297
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25118297	Poor sperm motility				Male infertility	DRP1 RanGAP1 Topoisomerase Ii? SUMO1
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq