• Gene id: 5899

Gene Summary

• Gene Symbol: RALB   Gene   UCSC   Ensembl
• Gene name: RAS like proto-oncogene B
• Alternate names: ras-related protein Ral-B, RALB Ras like proto-oncogene B, RAS-like protein B, ras related GTP binding protein B, v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein),
• Gene location: 2q14.2 (120252849: 120294710)     Exons: 6     NC_000002.12
• Gene summary(Entrez): This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. [provided by RefSeq, Ju
• OMIM: 179551

Protein Summary

• Protein general information: P11234  
  • Name: Ras related protein Ral B
  • Length: 206  
  • Mass: 23409
• Sequence:

  MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDY
  AAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEW
  GVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL

• Structural information:
  • Interpro: IPR027417  IPR028412  IPR005225  IPR001806  IPR020849  
  • Prosite: PS51421
  • PDB: 2KE5 2KWI
  • PDBsum: 2KE5 2KWI
  • STRING: ENSP00000272519
• Other Databases: GeneCards:  RALB  Malacards:  RALB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IBA	molecular function
GO:0005525	GTP binding	IBA	molecular function
GO:0007265	Ras protein signal transduction	IBA	biological process
GO:0019003	GDP binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0005525	GTP binding	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0030496	midbody	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0001928	regulation of exocyst assembly	ISS	biological process
GO:0060178	regulation of exocyst localization	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0007265	Ras protein signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005525	GTP binding	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030496	midbody	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0009267	cellular response to starvation	IDA	biological process
GO:0019003	GDP binding	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:2000786	positive regulation of autophagosome assembly	IMP	biological process
GO:0032091	negative regulation of protein binding	IMP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0071360	cellular response to exogenous dsRNA	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032092	positive regulation of protein binding	IMP	biological process
GO:0005525	GTP binding	IMP	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0071902	positive regulation of protein serine/threonine kinase activity	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa04072	Phospholipase D signaling pathway
hsa05210	Colorectal cancer
hsa05212	Pancreatic cancer

Diseases

Associated diseases	References
pancreatic adenocarcinoma	PMID:17174914
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq