• Gene id: 58985

Gene Summary

• Gene Symbol: IL22RA1   Gene   UCSC   Ensembl
• Aliases: CRF2-9, IL22R, IL22R1
• Gene name: interleukin 22 receptor subunit alpha 1
• Alternate names: interleukin-22 receptor subunit alpha-1, IL-22 receptor subunit alpha-1, IL-22R-alpha-1, IL-22RA1, cytokine receptor class-II member 9, cytokine receptor family 2 member 9, interleukin 22 receptor, alpha 1, zcytoR11,
• Gene location: 1p36.11 (24143178: 24119770)     Exons: 8     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the class II cytokine receptor family, and has been shown to be a receptor for interleukin 22 (IL22). IL22 receptor is a protein complex that consists of this protein and interleukin 10 receptor, beta (IL10BR/CR
• OMIM: 180247

Protein Summary

• Protein general information: Q8N6P7  
  • Name: Interleukin 22 receptor subunit alpha 1 (IL 22 receptor subunit alpha 1) (IL 22R alpha 1) (IL 22RA1) (Cytokine receptor class II member 9) (Cytokine receptor family 2 member 9) (CRF2 9) (ZcytoR11)
  • Length: 574  
  • Mass: 63077
  • Tissue specificity: Expressed in colon, liver, lung, pancreas and kidney. No expression in immune cells such as monocytes, T-cells, and NK-cells. Expressed in keratinocytes of normal skin as well as in psoriatic skin lesion. Detected in normal blood brain
• Sequence:

  MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRIT
  RKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGD
  GHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDR
  TWTYSFSGAFLFSMGFLVAVLCYLSYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ
  YSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQFP
  FYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEV
  TSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQ
  GPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWES

• Structural information:
  • Protein Domains: (17..12-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (141..22-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"-)
  • Interpro: IPR003961  IPR036116  IPR013783  
  • Prosite: PS50853
  • CDD: cd00063
  • PDB: 3DGC 3DLQ 6DF3
  • PDBsum: 3DGC 3DLQ 6DF3
  • DIP: 42031
  • STRING: ENSP00000270800
• Other Databases: GeneCards:  IL22RA1  Malacards:  IL22RA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042015	interleukin-20 binding	IEA	molecular function
GO:0050829	defense response to Gram-negative bacterium	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0004904	interferon receptor activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Endometriosis	INFBASE: 24133578
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881