• Gene id: 5898

Gene Summary

• Gene Symbol: RALA   Gene   UCSC   Ensembl
• Aliases: RAL
• Gene name: RAS like proto-oncogene A
• Alternate names: ras-related protein Ral-A, RALA Ras like proto-oncogene A, RAS-like protein A, Ras family small GTP binding protein RALA, ras related GTP binding protein A, v-ral simian leukemia viral oncogene homolog A (ras related),
• Gene location: 7p14.1 (127193130: 127198184)     Exons: 2     NC_000003.12
• Gene summary(Entrez): The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-lik
• OMIM: 179550

SNPs

rs553509

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000023.11   g.104013293T>C
NW_004070885.1   g.149709T>C
NG_016406.2   g.5396A>G
NM_001002916.4   c.368A>G
NC_000023.10   g.103267865C>T
NP_001002916.3   p.His123Arg|SEQ=[T/C]|GENE=H2BW1

rs7885967

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000023.11   g.104013669G>A
NW_004070885.1   g.150085G>A
NG_016406.2   g.5020C>T
NM_001002916.4   c.-9C>T
NC_000023.10   g.103268241G>A|SEQ=[G/A]|GENE=H2BW1

Protein Summary

• Protein general information: P11233  
  • Name: Ras related protein Ral A
  • Length: 206  
  • Mass: 23567
• Sequence:

  MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDY
  AAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWN
  VNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL

• Structural information:
  • Interpro: IPR027417  IPR028412  IPR005225  IPR001806  IPR020849  
  • Prosite: PS51421
  • PDB: 1UAD 1ZC3 1ZC4 2A78 2A9K 2BOV
  • PDBsum: 1UAD 1ZC3 1ZC4 2A78 2A9K 2BOV
  • STRING: ENSP00000005257
• Other Databases: GeneCards:  RALA  Malacards:  RALA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019003	GDP binding	IBA	molecular function
GO:0017157	regulation of exocytosis	IBA	biological process
GO:0007265	Ras protein signal transduction	IBA	biological process
GO:0005525	GTP binding	IBA	molecular function
GO:0003924	GTPase activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0051665	membrane raft localization	IDA	biological process
GO:0017157	regulation of exocytosis	IDA	biological process
GO:0032154	cleavage furrow	IDA	cellular component
GO:0031755	Edg-2 lysophosphatidic acid receptor binding	IDA	molecular function
GO:0030139	endocytic vesicle	IDA	colocalizes with
GO:0009986	cell surface	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0007265	Ras protein signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0006887	exocytosis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005525	GTP binding	TAS	molecular function
GO:0006935	chemotaxis	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0035722	interleukin-12-mediated signaling pathway	TAS	biological process
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0061024	membrane organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017157	regulation of exocytosis	IEA	biological process
GO:0051665	membrane raft localization	IEA	biological process
GO:0001843	neural tube closure	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051491	positive regulation of filopodium assembly	IDA	biological process
GO:0031532	actin cytoskeleton reorganization	IDA	biological process
GO:0090543	Flemming body	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0032154	cleavage furrow	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005525	GTP binding	IDA	molecular function
GO:0019003	GDP binding	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017022	myosin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04014	Ras signaling pathway
hsa05132	Salmonella infection
hsa04015	Rap1 signaling pathway
hsa04072	Phospholipase D signaling pathway
hsa05210	Colorectal cancer
hsa05212	Pancreatic cancer

Diseases

Associated diseases	References
pancreatic ductal adenocarcinoma	PMID:29113235
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray