• Gene id: 5893

Gene Summary

• Gene Symbol: RAD52   Gene   UCSC   Ensembl
• Gene name: RAD52 homolog, DNA repair protein
• Alternate names: DNA repair protein RAD52 homolog, recombination protein RAD52, rhabdomyosarcoma antigen MU-RMS-40.23,
• Gene location: 12p13.33 (991194: 911027)     Exons: 10     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Rad52, a protein important for DNA double-strand break repair and homologous recombination. This gene product was shown to bind single-stranded DNA ends, and mediate the DNA-
• OMIM: 600392

Protein Summary

• Protein general information: P43351  
  • Name: DNA repair protein RAD52 homolog
  • Length: 418  
  • Mass: 46169
• Sequence:

  MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLA
  NEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDG
  LKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSP
  SRPSHAVIPADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHST
  PVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHSVC
  HQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS

• Structural information:
  • Interpro: IPR004585  IPR041247  IPR007232  IPR042525  
  • PDB: 1H2I 1KN0 5JRB 5XRZ 5XS0
  • PDBsum: 1H2I 1KN0 5JRB 5XRZ 5XS0
  • DIP: 333
  • STRING: ENSP00000351284
• Other Databases: GeneCards:  RAD52  Malacards:  RAD52

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006312	mitotic recombination	IBA	biological process
GO:0045002	double-strand break repair via single-strand annealing	IBA	biological process
GO:0000724	double-strand break repair via homologous recombination	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0006310	DNA recombination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0045002	double-strand break repair via single-strand annealing	IEA	biological process
GO:0000724	double-strand break repair via homologous recombination	IEA	biological process
GO:0000730	DNA recombinase assembly	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006310	DNA recombination	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0006310	DNA recombination	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006302	double-strand break repair	TAS	biological process
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0010792	DNA double-strand break processing involved in repair via single-strand annealing	IDA	biological process
GO:2000819	regulation of nucleotide-excision repair	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0003677	DNA binding	IDA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IGI	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034599	cellular response to oxidative stress	IEA	biological process
GO:0010792	DNA double-strand break processing involved in repair via single-strand annealing	IEA	biological process
GO:0000724	double-strand break repair via homologous recombination	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006310	DNA recombination	IMP	biological process
GO:0003697	single-stranded DNA binding	IMP	molecular function
GO:0032993	protein-DNA complex	IMP	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03440	Homologous recombination

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray