Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 5892
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol RAD51D   Gene   UCSC   Ensembl
Aliases BROVCA4, R51H3, RAD51L3, TRAD
Gene name RAD51 paralog D
Alternate names DNA repair protein RAD51 homolog 4, RAD51 homolog D, RAD51-like protein 3, recombination repair protein,
Gene location 17q12 (35119868: 35092220)     Exons: 11     NC_000017.11
Gene summary(Entrez) The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, which are known to be involved in the homologous recombination and repair of DNA. This
OMIM 607974

Protein Summary
Protein general information O75771  

Name: DNA repair protein RAD51 homolog 4 (R51H3) (RAD51 homolog D) (RAD51 like protein 3) (TRAD)

Length: 328  Mass: 35049

Tissue specificity: Expressed in colon, prostate, spleen, testis, ovary, thymus and small intestine. Weakly expressed in leukocytes.

Sequence MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGADLYEEL
KTSTAILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCMAANVAHGLQQNVLYVDSNGGLTASRLLQLL
QAKTQDEEEQAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVTGSSGTVKVVVVDSVTAVVSPLLGGQQREGLA
LMMQLARELKTLARDLGMAVVVTNHITRDRDSGRLKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSR
QPTGFQEMVDIGTWGTSEQSATLQGDQT
Structural information
Interpro:  IPR003593  IPR013632  IPR016467  IPR027417  IPR020588  
Prosite:   PS50162

PDB:  		 2KZ3
PDBsum:   2KZ3

DIP:  
24265
MINT:  
STRING:   ENSP00000466834
Other Databases GeneCards:  RAD51D  Malacards:  RAD51D

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0042148 strand invasion
 IBA biological process
GO:0033063 Rad51B-Rad51C-Rad51D-XRCC
2 complex
 IBA cellular component
GO:0008094 DNA-dependent ATPase acti
vity
 IBA molecular function
GO:0005813 centrosome
 IBA cellular component
GO:0000723 telomere maintenance
 IBA biological process
GO:0007131 reciprocal meiotic recomb
ination
 IBA biological process
GO:0005657 replication fork
 IBA cellular component
GO:0003697 single-stranded DNA bindi
ng
 IBA molecular function
GO:0000784 nuclear chromosome, telom
eric region
 IBA cellular component
GO:0000724 double-strand break repai
r via homologous recombin
ation
 IBA biological process
GO:0000400 four-way junction DNA bin
ding
 IBA contributes to
GO:0042148 strand invasion
 IDA biological process
GO:0033063 Rad51B-Rad51C-Rad51D-XRCC
2 complex
 IDA cellular component
GO:0008094 DNA-dependent ATPase acti
vity
 IDA molecular function
GO:0005813 centrosome
 IDA cellular component
GO:0000781 chromosome, telomeric reg
ion
 IDA cellular component
GO:0043015 gamma-tubulin binding
 IDA molecular function
GO:0005657 replication fork
 IDA cellular component
GO:0003697 single-stranded DNA bindi
ng
 IDA molecular function
GO:0000400 four-way junction DNA bin
ding
 IDA contributes to
GO:0000723 telomere maintenance
 IMP biological process
GO:0000724 double-strand break repai
r via homologous recombin
ation
 IMP biological process
GO:0006281 DNA repair
 IEA biological process
GO:0008094 DNA-dependent ATPase acti
vity
 IEA molecular function
GO:0003677 DNA binding
 IEA molecular function
GO:0005524 ATP binding
 IEA molecular function
GO:0006281 DNA repair
 IEA biological process
GO:0000781 chromosome, telomeric reg
ion
 IEA cellular component
GO:0005856 cytoskeleton
 IEA cellular component
GO:0006974 cellular response to DNA
damage stimulus
 IEA biological process
GO:0005634 nucleus
 IEA cellular component
GO:0006310 DNA recombination
 IEA biological process
GO:0003677 DNA binding
 IEA molecular function
GO:0005524 ATP binding
 IEA molecular function
GO:0005737 cytoplasm
 IEA cellular component
GO:0005694 chromosome
 IEA cellular component
GO:0000166 nucleotide binding
 IEA molecular function
GO:0003677 DNA binding
 TAS molecular function
GO:0005634 nucleus
 TAS cellular component
GO:0007131 reciprocal meiotic recomb
ination
 TAS biological process
GO:0006281 DNA repair
 TAS biological process
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0051276 chromosome organization
 IEA biological process
GO:0006974 cellular response to DNA
damage stimulus
 IEA biological process
GO:0000784 nuclear chromosome, telom
eric region
 IEA cellular component
GO:0051726 regulation of cell cycle
 IEA biological process
GO:0036297 interstrand cross-link re
pair
 IEA biological process
GO:0000723 telomere maintenance
 IEA biological process
GO:0000784 nuclear chromosome, telom
eric region
 IDA cellular component
GO:0000781 chromosome, telomeric reg
ion
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005815 microtubule organizing ce
nter
 IEA cellular component
GO:0042148 strand invasion
 IBA biological process
GO:0033063 Rad51B-Rad51C-Rad51D-XRCC
2 complex
 IBA cellular component
GO:0008094 DNA-dependent ATPase acti
vity
 IBA molecular function
GO:0005813 centrosome
 IBA cellular component
GO:0000723 telomere maintenance
 IBA biological process
GO:0007131 reciprocal meiotic recomb
ination
 IBA biological process
GO:0005657 replication fork
 IBA cellular component
GO:0003697 single-stranded DNA bindi
ng
 IBA molecular function
GO:0000784 nuclear chromosome, telom
eric region
 IBA cellular component
GO:0000724 double-strand break repai
r via homologous recombin
ation
 IBA biological process
GO:0000400 four-way junction DNA bin
ding
 IBA contributes to
GO:0042148 strand invasion
 IDA biological process
GO:0033063 Rad51B-Rad51C-Rad51D-XRCC
2 complex
 IDA cellular component
GO:0008094 DNA-dependent ATPase acti
vity
 IDA molecular function
GO:0005813 centrosome
 IDA cellular component
GO:0000781 chromosome, telomeric reg
ion
 IDA cellular component
GO:0043015 gamma-tubulin binding
 IDA molecular function
GO:0005657 replication fork
 IDA cellular component
GO:0003697 single-stranded DNA bindi
ng
 IDA molecular function
GO:0000400 four-way junction DNA bin
ding
 IDA contributes to
GO:0000723 telomere maintenance
 IMP biological process
GO:0000724 double-strand break repai
r via homologous recombin
ation
 IMP biological process
GO:0006281 DNA repair
 IEA biological process
GO:0008094 DNA-dependent ATPase acti
vity
 IEA molecular function
GO:0003677 DNA binding
 IEA molecular function
GO:0005524 ATP binding
 IEA molecular function
GO:0006281 DNA repair
 IEA biological process
GO:0000781 chromosome, telomeric reg
ion
 IEA cellular component
GO:0005856 cytoskeleton
 IEA cellular component
GO:0006974 cellular response to DNA
damage stimulus
 IEA biological process
GO:0005634 nucleus
 IEA cellular component
GO:0006310 DNA recombination
 IEA biological process
GO:0003677 DNA binding
 IEA molecular function
GO:0005524 ATP binding
 IEA molecular function
GO:0005737 cytoplasm
 IEA cellular component
GO:0005694 chromosome
 IEA cellular component
GO:0000166 nucleotide binding
 IEA molecular function
GO:0003677 DNA binding
 TAS molecular function
GO:0005634 nucleus
 TAS cellular component
GO:0007131 reciprocal meiotic recomb
ination
 TAS biological process
GO:0006281 DNA repair
 TAS biological process
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0051276 chromosome organization
 IEA biological process
GO:0006974 cellular response to DNA
damage stimulus
 IEA biological process
GO:0000784 nuclear chromosome, telom
eric region
 IEA cellular component
GO:0051726 regulation of cell cycle
 IEA biological process
GO:0036297 interstrand cross-link re
pair
 IEA biological process
GO:0000723 telomere maintenance
 IEA biological process
GO:0000784 nuclear chromosome, telom
eric region
 IDA cellular component
GO:0000781 chromosome, telomeric reg
ion
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005815 microtubule organizing ce
nter
 IEA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa03440Homologous recombination

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Male factor infertility MIK: 29961538
Spermatogenic defects MIK: 31037746

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract
29961538 Male facto
r infertil
ity
318 (128 couple
s presenting wi
th OAT (MF) and
118 maternal a
ge-matched cont
rol (no MF) sub
jects undergoin
g infertility t
reatment, 72 su
rplus cryoprese
rved blastocyst
s)
 Male infertility RNA-seq
 Show abstract
31037746 Spermatoge
nic defect
s
28 men with az
oospermia
 Male infertility Microarray
 Show abstract