• Gene id: 5890

Gene Summary

• Gene Symbol: RAD51B   Gene   UCSC   Ensembl
• Aliases: R51H2, RAD51L1, REC2
• Gene name: RAD51 paralog B
• Alternate names: DNA repair protein RAD51 homolog 2, RAD51 homolog B, RecA-like protein, recombination repair protein,
• Gene location: 14q24.1 (67819778: 68683117)     Exons: 19     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutionarily conserved proteins essential for DNA repair by homologous recombination. This protein has been shown to form a stable heterodimer with the fa

Protein Summary

• Protein general information: O15315  
  • Name: DNA repair protein RAD51 homolog 2 (R51H2) (RAD51 homolog B) (Rad51B) (RAD51 like protein 1)
  • Length: 384  
  • Mass: 42196
  • Tissue specificity: Expressed in a wide range of tissues.
• Sequence:

  MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRS
  ADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAE
  RLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQ
  GNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTW
  SHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWAPEILPPQPPEQLGLQ
  MCHHTQLIF

• Structural information:
  • Interpro: IPR003593  IPR013632  IPR016467  IPR027417  IPR033925   IPR030548  IPR020588  
  • Prosite: PS50162
  • CDD: cd01123
  • DIP: 41246
  • STRING: ENSP00000419471
• Other Databases: GeneCards:  RAD51B  Malacards:  RAD51B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033063	Rad51B-Rad51C-Rad51D-XRCC2 complex	IBA	cellular component
GO:0008094	DNA-dependent ATPase activity	IBA	molecular function
GO:0003690	double-stranded DNA binding	IBA	molecular function
GO:0005657	replication fork	IBA	cellular component
GO:0003697	single-stranded DNA binding	IBA	molecular function
GO:0000724	double-strand break repair via homologous recombination	IBA	biological process
GO:0000400	four-way junction DNA binding	IBA	contributes to
GO:0033063	Rad51B-Rad51C-Rad51D-XRCC2 complex	IDA	cellular component
GO:0008094	DNA-dependent ATPase activity	IDA	molecular function
GO:0003690	double-stranded DNA binding	IDA	molecular function
GO:0005657	replication fork	IDA	cellular component
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0000400	four-way junction DNA binding	IDA	contributes to
GO:0010971	positive regulation of G2/M transition of mitotic cell cycle	IMP	biological process
GO:0000724	double-strand break repair via homologous recombination	IMP	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0008094	DNA-dependent ATPase activity	IEA	molecular function
GO:0033063	Rad51B-Rad51C-Rad51D-XRCC2 complex	IEA	cellular component
GO:0000724	double-strand break repair via homologous recombination	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006310	DNA recombination	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0003677	DNA binding	TAS	molecular function
GO:0006281	DNA repair	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0006310	DNA recombination	TAS	biological process
GO:0007131	reciprocal meiotic recombination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0033063	Rad51B-Rad51C-Rad51D-XRCC2 complex	IBA	cellular component
GO:0008094	DNA-dependent ATPase activity	IBA	molecular function
GO:0003690	double-stranded DNA binding	IBA	molecular function
GO:0005657	replication fork	IBA	cellular component
GO:0003697	single-stranded DNA binding	IBA	molecular function
GO:0000724	double-strand break repair via homologous recombination	IBA	biological process
GO:0000400	four-way junction DNA binding	IBA	contributes to
GO:0033063	Rad51B-Rad51C-Rad51D-XRCC2 complex	IDA	cellular component
GO:0008094	DNA-dependent ATPase activity	IDA	molecular function
GO:0003690	double-stranded DNA binding	IDA	molecular function
GO:0005657	replication fork	IDA	cellular component
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0000400	four-way junction DNA binding	IDA	contributes to
GO:0010971	positive regulation of G2/M transition of mitotic cell cycle	IMP	biological process
GO:0000724	double-strand break repair via homologous recombination	IMP	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0008094	DNA-dependent ATPase activity	IEA	molecular function
GO:0033063	Rad51B-Rad51C-Rad51D-XRCC2 complex	IEA	cellular component
GO:0000724	double-strand break repair via homologous recombination	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006310	DNA recombination	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0003677	DNA binding	TAS	molecular function
GO:0006281	DNA repair	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0006310	DNA recombination	TAS	biological process
GO:0007131	reciprocal meiotic recombination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03440	Homologous recombination

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray