• Gene id: 5889

Gene Summary

• Gene Symbol: RAD51C   Gene   UCSC   Ensembl
• Aliases: BROVCA3, FANCO, R51H3, RAD51L2
• Gene name: RAD51 paralog C
• Alternate names: DNA repair protein RAD51 homolog 3, RAD51-like protein 2, yeast RAD51 homolog 3,
• Gene location: 17q22 (58692139: 58735610)     Exons: 12     NC_000017.11
• Gene summary(Entrez): This gene is a member of the RAD51 family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51 and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with other RA
• OMIM: 602774

Protein Summary

• Protein general information: O43502  
  • Name: DNA repair protein RAD51 homolog 3 (R51H3) (RAD51 homolog C) (RAD51 like protein 2)
  • Length: 376  
  • Mass: 42190
  • Tissue specificity: Expressed in a variety of tissues, with highest expression in testis, heart muscle, spleen and prostate.
• Sequence:

  MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRY
  AGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQLCMQLAVDVQIPECFGG
  VAGEAVFIDTEGSFMVDRVVDLATACIQHLQLIAEKHKGEEHRKALEDFTLDNILSHIYYFRCRDYTELLAQVYL
  LPDFLSEHSKVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKIDRNQALLVPA
  LGESWGHAATIRLIFHWDRKQRLATLYKSPSQKECTVLFQIKPQGFRDTVVTSACSLQTEGSLSTRKRSRDPEEE
  L

• Structural information:
  • Interpro: IPR013632  IPR016467  IPR027417  IPR033925  IPR020588  
  • Prosite: PS50162
  • CDD: cd01123
  • DIP: 41247
  • STRING: ENSP00000336701
• Other Databases: GeneCards:  RAD51C  Malacards:  RAD51C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006281	DNA repair	IBA	biological process
GO:0008821	crossover junction endodeoxyribonuclease activity	IBA	contributes to
GO:0033063	Rad51B-Rad51C-Rad51D-XRCC2 complex	IBA	cellular component
GO:0033065	Rad51C-XRCC3 complex	IBA	cellular component
GO:0048476	Holliday junction resolvase complex	IBA	colocalizes with
GO:0000400	four-way junction DNA binding	IBA	contributes to
GO:0005657	replication fork	IBA	cellular component
GO:0007131	reciprocal meiotic recombination	IBA	biological process
GO:0048476	Holliday junction resolvase complex	IDA	colocalizes with
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0033065	Rad51C-XRCC3 complex	IDA	cellular component
GO:0033063	Rad51B-Rad51C-Rad51D-XRCC2 complex	IDA	cellular component
GO:0006281	DNA repair	IDA	biological process
GO:0006310	DNA recombination	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005657	replication fork	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000400	four-way junction DNA binding	IDA	contributes to
GO:0010971	positive regulation of G2/M transition of mitotic cell cycle	IMP	biological process
GO:0008821	crossover junction endodeoxyribonuclease activity	IMP	contributes to
GO:0007062	sister chromatid cohesion	ISS	biological process
GO:0000724	double-strand break repair via homologous recombination	IMP	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0008094	DNA-dependent ATPase activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006310	DNA recombination	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	TAS	molecular function
GO:0006281	DNA repair	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0006310	DNA recombination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008821	crossover junction endodeoxyribonuclease activity	IEA	molecular function
GO:0007283	spermatogenesis	IEA	biological process
GO:0007141	male meiosis I	IEA	biological process
GO:0007131	reciprocal meiotic recombination	IEA	biological process
GO:0007066	female meiosis sister chromatid cohesion	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000722	telomere maintenance via recombination	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03460	Fanconi anemia pathway
hsa03440	Homologous recombination

Diseases

Associated diseases	References
Fanconi anemia	KEGG:H00238
Fanconi anemia	KEGG:H00238
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881